FXYD3 Antibody - BSA Free

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256] - Staining in human prostate and pancreas tissues using anti-FXYD3 antibody. Corresponding FXYD3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: FXYD3 Antibody [NBP1-81256] - Staining of human prostate shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FXYD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FXYD3 Antibody - BSA Free (NBP1-81256) is a polyclonal antibody validated for use in IHC. Anti-FXYD3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FXYD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FXYD3 Protein (NBP1-81256PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19893046)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FXYD3 Antibody - BSA Free

• Chloride conductance inducer protein Mat-8
• FXYD domain containing ion transport regulator 3
• FXYD domain-containing ion transport regulator 3
• Mammary tumor 8 kDa protein
• MAT8MAT-8
• phospholemman-like protein
• Phospholemman-like
• PLMLMGC111076

Background

FXYD3, also known as FXYD domain-containing ion transport regulator 3, consists of 3 isoforms, a 87 amino acid isoform that is 9 kDa, a 113 amino acid isoform that is 12 kDa, and a 144 amino acid that is 15 kDa; is membrane located, functions as an inducer of a hyperpolarization-activated chloride current when expressed in Xenopus oocytes, and may be a modulator capable of activating endogenous oocyte channels. Current research is being performed on several diseases and disorders including adenocarcinoma, pancreatic, ductal adenocarcinoma, intrahepatic cholangiocarcinoma, colorectal cancer, cholangiocarcinoma prostate carcinoma, melanoma, pancreatic cancer, pancreatitis, prostate cancer, breast cancer, and prostatitis. The FXYD3 protein has also shown an interaction with SERBP1, FBXL12, NR4A1, MAPK6 and NUDT3, in the regulation of catalytic activity, ion transport, and chloride transport pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FXYD3 Antibody (NBP1-81256)(1)

Publication using NBP1-81256

• Okudela K, Yazawa T, Ishii J et al. Down-regulation of FXYD3 expression in human lung cancers: its mechanism and potential role in carcinogenesis. Am J Pathol 2009-12-01 [PMID: 19893046]

Bioinformatics

• Gene Symbol: FXYD3