Recombinant Human FXYD2 GST (N-Term) Protein

SDS-Page: Recombinant Human FXYD2 Protein [H00000486-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human FXYD2 GST (N-Term) Protein Summary

• Description: Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 64 of Human FXYD2 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: FXYD2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 32.78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FXYD2 GST (N-Term) Protein

• ATP1C
• ATP1G1
• ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
• FXYD domain containing ion transport regulator 2
• FXYD domain-containing ion transport regulator 2
• FXYD2
• HOMG2
• hypomagnesemia 2, renal
• MGC12372
• Na(+)/K(+) ATPase subunit gamma
• Sodium pump gamma chain
• sodium/potassium-transporting ATPase subunit gamma
• Sodium-potassium-ATPase, gamma polypeptide

Background

FXYD2( AAH05302, 1 a.a. - 65 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

FAQs for FXYD2 Recombinant Protein (H00000486-P01). (Showing 1 - 1 of 1 FAQ).

1. This protein is coupled to a GST tag. Is it possible to have the same protein but without this tag?
   • The supplier of this product is Abnova and their team can probably remove the GST tag, but considering the time/cost it may take, this is not something what we would recommend. GST Precision removal kit from GE would be a better option for you, however, removal of the GST tag does not necessarily guarantee that the protein will return to its native confirmation.

Bioinformatics

• Gene Symbol: FXYD2