Recombinant Human FXYD2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FXYD2 Protein [H00000486-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human FXYD2 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 64 of Human FXYD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FXYD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
32.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FXYD2 GST (N-Term) Protein

  • ATP1C
  • ATP1G1
  • ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
  • FXYD domain containing ion transport regulator 2
  • FXYD domain-containing ion transport regulator 2
  • FXYD2
  • HOMG2
  • hypomagnesemia 2, renal
  • MGC12372
  • Na(+)/K(+) ATPase subunit gamma
  • Sodium pump gamma chain
  • sodium/potassium-transporting ATPase subunit gamma
  • Sodium-potassium-ATPase, gamma polypeptide

Background

FXYD2( AAH05302, 1 a.a. - 65 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for FXYD2 Recombinant Protein (H00000486-P01) (0)

There are no publications for FXYD2 Recombinant Protein (H00000486-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD2 Recombinant Protein (H00000486-P01) (0)

There are no reviews for FXYD2 Recombinant Protein (H00000486-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXYD2 Recombinant Protein (H00000486-P01). (Showing 1 - 1 of 1 FAQ).

  1. This protein is coupled to a GST tag. Is it possible to have the same protein but without this tag?
    • The supplier of this product is Abnova and their team can probably remove the GST tag, but considering the time/cost it may take, this is not something what we would recommend. GST Precision removal kit from GE would be a better option for you, however, removal of the GST tag does not necessarily guarantee that the protein will return to its native confirmation.

Additional FXYD2 Products

Blogs on FXYD2

There are no specific blogs for FXYD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FXYD2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD2