Recombinant Human FXYD2 Protein

Images

 
SDS-Page: Recombinant Human FXYD2 Protein [H00000486-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FXYD2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 64 of Human FXYD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FXYD2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FXYD2 Protein

  • ATP1C
  • ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
  • FXYD domain containing ion transport regulator 2
  • FXYD domain-containing ion transport regulator 2
  • HOMG2
  • hypomagnesemia 2, renal
  • MGC12372
  • Na(+)/K(+) ATPase subunit gamma
  • Sodium pump gamma chain
  • sodium/potassium-transporting ATPase subunit gamma
  • Sodium-potassium-ATPase, gamma polypeptide

Background

FXYD2( AAH05302, 1 a.a. - 65 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79193
Species: Hu
Applications: WB
NBP2-48725
Species: Hu
Applications: WB, IHC, IHC-P
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86404
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01991
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4965
Species: Mu
Applications: WB, Simple Western, IHC
AF7318
Species: Hu
Applications: IHC
AF3646
Species: Hu
Applications: WB, ICC
AF3444
Species: Hu
Applications: WB
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
AF8355
Species: Hu
Applications: WB, IHC
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
H00000486-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FXYD2 Recombinant Protein (H00000486-P01) (0)

There are no publications for FXYD2 Recombinant Protein (H00000486-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD2 Recombinant Protein (H00000486-P01) (0)

There are no reviews for FXYD2 Recombinant Protein (H00000486-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXYD2 Recombinant Protein (H00000486-P01). (Showing 1 - 1 of 1 FAQ).

  1. This protein is coupled to a GST tag. Is it possible to have the same protein but without this tag?
    • The supplier of this product is Abnova and their team can probably remove the GST tag, but considering the time/cost it may take, this is not something what we would recommend. GST Precision removal kit from GE would be a better option for you, however, removal of the GST tag does not necessarily guarantee that the protein will return to its native confirmation.

Additional FXYD2 Products

Bioinformatics Tool for FXYD2 Recombinant Protein (H00000486-P01)

Discover related pathways, diseases and genes to FXYD2 Recombinant Protein (H00000486-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXYD2 Recombinant Protein (H00000486-P01)

Discover more about diseases related to FXYD2 Recombinant Protein (H00000486-P01).
 

Pathways for FXYD2 Recombinant Protein (H00000486-P01)

View related products by pathway.

PTMs for FXYD2 Recombinant Protein (H00000486-P01)

Learn more about PTMs related to FXYD2 Recombinant Protein (H00000486-P01).

Blogs on FXYD2

There are no specific blogs for FXYD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NKX6.1 Antibody
NBP1-49672

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FXYD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD2