FVT1 Antibody

Images

 
Immunohistochemistry: FVT1 Antibody [NBP2-38534] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FVT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYL
Specificity
Specificity of human FVT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KDSR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FVT1 Protein (NBP2-38534PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FVT1 Antibody

  • 3-ketodihydrosphingosine reductase
  • DHSR
  • EC 1.1.1.102,3-dehydrosphinganine reductase
  • FLJ36555
  • FLJ92680
  • follicular lymphoma variant translocation 1
  • Follicular variant translocation protein 1
  • FVT-1
  • FVT1KDS reductase
  • SDR35C1
  • short chain dehydrogenase/reductase family 35C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03595
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
AF844
Species: Mu
Applications: WB, Block
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55276
Species: Hu
Applications: WB, ICC/IF
NBP2-67019
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-67623
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-88602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38534
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for FVT1 Antibody (NBP2-38534) (0)

There are no publications for FVT1 Antibody (NBP2-38534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FVT1 Antibody (NBP2-38534) (0)

There are no reviews for FVT1 Antibody (NBP2-38534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FVT1 Antibody (NBP2-38534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FVT1 Antibody (NBP2-38534)

Discover related pathways, diseases and genes to FVT1 Antibody (NBP2-38534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FVT1

There are no specific blogs for FVT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FVT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KDSR
Uniprot