FUSIP1 Antibody - BSA Free

Western Blot: FUSIP1 Antibody [NBP1-57428] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate FUSIP1 is supported by BioGPS gene expression data to be expressed in HepG2

Immunohistochemistry: FUSIP1 Antibody [NBP1-57428] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400

Immunohistochemistry: FUSIP1 Antibody [NBP1-57428] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FUSIP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FUSIP1(FUS interacting protein (serine/arginine-rich) 1) The peptide sequence was selected from the C terminal of FUSIP1. Peptide sequence TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRSF10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FUSIP1 Antibody - BSA Free

• 40 kDa SR-repressor protein
• FLJ43846
• FUS interacting protein (serine-arginine rich) 1
• FUS-interacting protein (serine-arginine rich) 2
• FUS-interacting serine-arginine-rich protein 1
• FUSIP1DKFZp686H0644
• FUSIP2
• neural-salient SR protein
• NSSR
• serine/arginine-rich splicing factor 10
• serine-arginine repressor protein (40 kDa)
• SFRS13
• SFRS13A
• Splicing factor SRp38
• splicing factor, arginine/serine-rich 13
• Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
• SR splicing factor 10
• SRp38
• SRrp40TLS-associated protein with SR repeats
• TASR1TLS-associated SR protein
• TASR2FUS interacting protein (serine/arginine-rich) 1
• TASRFLJ30749
• TLS-associated protein TASR
• TLS-associated serine-arginine protein 1
• TLS-associated serine-arginine protein 2
• TLS-associated serine-arginine protein

Background

FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRSF10
• Uniprot:
  • O75494(Human)