Recombinant Human Fucosyltransferase 3/FUT3 Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 82-150 of Human Blood Group Lewis b Source: Wheat Germ Amino Acid Sequence: SEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALD |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
FUT3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
33.33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Fucosyltransferase 3/FUT3 Protein
Background
The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01) (0)
There are no publications for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01) (0)
There are no reviews for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01) (0)
Additional Fucosyltransferase 3/FUT3 Products
Blogs on Fucosyltransferase 3/FUT3