We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Fucosyltransferase 3/FUT3 Protein

Images

 

Order Details


    • Catalog Number
      H00002525-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Fucosyltransferase 3/FUT3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 82-150 of Human Blood Group Lewis b

Source: Wheat Germ

Amino Acid Sequence: SEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALD

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FUT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
33.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fucosyltransferase 3/FUT3 Protein

  • CD174
  • FT3B
  • Fucosyltransferase 3
  • FucT-III
  • FUT3
  • LE
  • Les
  • Lewis FT

Background

The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3844
Species: Hu, Mu
Applications: IHC
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45283
Species: Hu, Mu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-69822
Species: Hu
Applications: ELISA
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
7770-GT
Species: Hu
Applications: EnzAct
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP3-15385
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-07622
Species: Hu
Applications: ELISA, ICC/IF, WB
H00002525-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01) (0)

There are no publications for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01) (0)

There are no reviews for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fucosyltransferase 3/FUT3 Partial Recombinant Protein (H00002525-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fucosyltransferase 3/FUT3 Products

Blogs on Fucosyltransferase 3/FUT3

There are no specific blogs for Fucosyltransferase 3/FUT3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fucosyltransferase 3/FUT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT3