Recombinant Human FTSJ1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FTSJ1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-329 of Human FTSJ1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FTSJ1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FTSJ1 Protein

  • CDLIV
  • cell division protein
  • EC 2.1.1.-
  • FtsJ homolog 1 (E. coli)
  • JM23
  • mental retardation, X-linked 44
  • mental retardation, X-linked 9
  • MRX44
  • Protein ftsJ homolog 1
  • putative ribosomal RNA methyltransferase 1
  • rRNA (uridine-2'-O-)-methyltransferase
  • SPB1MRX9
  • TRM7

Background

FTSJ1( AAH23584, 1 a.a. - 330 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP2-52493
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81681
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5158
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-88828
Species: Hu
Applications: IHC, IHC-P
NBP1-54805
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for FTSJ1 Recombinant Protein (H00024140-P01) (0)

There are no publications for FTSJ1 Recombinant Protein (H00024140-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTSJ1 Recombinant Protein (H00024140-P01) (0)

There are no reviews for FTSJ1 Recombinant Protein (H00024140-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTSJ1 Recombinant Protein (H00024140-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FTSJ1 Products

Bioinformatics Tool for FTSJ1 Recombinant Protein (H00024140-P01)

Discover related pathways, diseases and genes to FTSJ1 Recombinant Protein (H00024140-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FTSJ1 Recombinant Protein (H00024140-P01)

Discover more about diseases related to FTSJ1 Recombinant Protein (H00024140-P01).
 

Pathways for FTSJ1 Recombinant Protein (H00024140-P01)

View related products by pathway.

PTMs for FTSJ1 Recombinant Protein (H00024140-P01)

Learn more about PTMs related to FTSJ1 Recombinant Protein (H00024140-P01).

Blogs on FTSJ1

There are no specific blogs for FTSJ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Synapsin I Antibody
NB300-104-100ul
FTSJ1 Antibody
NBP1-85703
ATRX Antibody
NBP1-83077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FTSJ1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FTSJ1