FSBP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FSBP Antibody [NBP2-55242] - Staining of human cell line RT4 shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FSBP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSBP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FSBP Recombinant Protein Antigen (NBP2-55242PEP)

Reactivity Notes

Mouse 87%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FSBP Antibody

  • fibrinogen silencer binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
DSHBG0B
Species: Hu
Applications: ELISA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-41182
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DFN00
Species: Hu
Applications: ELISA
H00005018-D01P
Species: Hu
Applications: ICC/IF, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-00521
Species: Hu
Applications: Flow, IHC, IHC-P, WB
MAB3838
Species: Rt
Applications: IHC, WB
NB500-186
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for FSBP Antibody (NBP2-55242) (0)

There are no publications for FSBP Antibody (NBP2-55242).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSBP Antibody (NBP2-55242) (0)

There are no reviews for FSBP Antibody (NBP2-55242). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FSBP Antibody (NBP2-55242) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FSBP Products

Array NBP2-55242

Bioinformatics Tool for FSBP Antibody (NBP2-55242)

Discover related pathways, diseases and genes to FSBP Antibody (NBP2-55242). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSBP Antibody (NBP2-55242)

Discover more about diseases related to FSBP Antibody (NBP2-55242).
 

Pathways for FSBP Antibody (NBP2-55242)

View related products by pathway.

PTMs for FSBP Antibody (NBP2-55242)

Learn more about PTMs related to FSBP Antibody (NBP2-55242).
 

Research Areas for FSBP Antibody (NBP2-55242)

Find related products by research area.

Blogs on FSBP

There are no specific blogs for FSBP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSBP