Frizzled-7 Antibody (4D9)

Images

 
Western Blot: Frizzled-7 Antibody (4D9) [H00008324-M03] - Analysis of FZD7 expression in K-562 (Cat # L009V1).
Immunohistochemistry-Paraffin: Frizzled-7 Antibody (4D9) [H00008324-M03] - Analysis of monoclonal antibody to FZD7 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Sandwich ELISA: Frizzled-7 Antibody (4D9) [H00008324-M03] - Detection limit for recombinant GST tagged FZD7 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Frizzled-7 Antibody (4D9) Summary

Immunogen
FZD7 (NP_003498.1 155 a.a. - 253 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA
Specificity
frizzled homolog 7 (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FZD7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Frizzled-7 Antibody (4D9)

  • frizzled (Drosophila) homolog 7
  • frizzled homolog 7 (Drosophila)
  • Frizzled, drosophila, homolog of, 7
  • Frizzled7
  • Frizzled-7
  • fz-7
  • FZD7
  • FzE3frizzled-7
  • hFz7

Background

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1120
Species: Mu
Applications: WB, IHC
AF1617
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46367
Species: Hu
Applications: WB, IHC
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-2439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
645-WN/CF
Species: Hu, Mu
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-23659
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
H00008324-M03
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Frizzled-7 Antibody (H00008324-M03) (0)

There are no publications for Frizzled-7 Antibody (H00008324-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-7 Antibody (H00008324-M03) (0)

There are no reviews for Frizzled-7 Antibody (H00008324-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-7 Antibody (H00008324-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frizzled-7 Products

Bioinformatics Tool for Frizzled-7 Antibody (H00008324-M03)

Discover related pathways, diseases and genes to Frizzled-7 Antibody (H00008324-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-7 Antibody (H00008324-M03)

Discover more about diseases related to Frizzled-7 Antibody (H00008324-M03).
 

Pathways for Frizzled-7 Antibody (H00008324-M03)

View related products by pathway.

PTMs for Frizzled-7 Antibody (H00008324-M03)

Learn more about PTMs related to Frizzled-7 Antibody (H00008324-M03).
 

Research Areas for Frizzled-7 Antibody (H00008324-M03)

Find related products by research area.

Blogs on Frizzled-7

There are no specific blogs for Frizzled-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-7 Antibody (4D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD7
Entrez
Uniprot