Frataxin Antibody (3E7.)

Images

 
ELISA: Frataxin Antibody (3E7) [H00002395-M05] - Detection limit for recombinant GST tagged FXN is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Frataxin Antibody (3E7.) Summary

Immunogen
FXN (AAH48097.1, 91 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Specificity
FXN - frataxin (3E7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FXN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Frataxin Antibody (3E7.)

  • CyaY
  • EC 1.16.3.1
  • FA
  • FARRmitochondrial
  • frataxin
  • Friedreich ataxia protein
  • Friedreich ataxia
  • Fxn
  • X25MGC57199

Background

This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-15447
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-07799
Species: Hu
NBL1-11664
Species: Hu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Frataxin Antibody (H00002395-M05) (0)

There are no publications for Frataxin Antibody (H00002395-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frataxin Antibody (H00002395-M05) (0)

There are no reviews for Frataxin Antibody (H00002395-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frataxin Antibody (H00002395-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frataxin Products

Bioinformatics Tool for Frataxin Antibody (H00002395-M05)

Discover related pathways, diseases and genes to Frataxin Antibody (H00002395-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frataxin Antibody (H00002395-M05)

Discover more about diseases related to Frataxin Antibody (H00002395-M05).
 

Pathways for Frataxin Antibody (H00002395-M05)

View related products by pathway.

PTMs for Frataxin Antibody (H00002395-M05)

Learn more about PTMs related to Frataxin Antibody (H00002395-M05).
 

Research Areas for Frataxin Antibody (H00002395-M05)

Find related products by research area.

Blogs on Frataxin

There are no specific blogs for Frataxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frataxin Antibody (3E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol FXN
Entrez
Uniprot