FRA-1/FOSL1 Antibody

Images

 
Western Blot: FRA-1/FOSL1 Antibody [H00008061-D01P] - Analysis of FOSL1 expression in A-431.
Western Blot: FRA-1/FOSL1 Antibody [H00008061-D01P] - Analysis of FOSL1 expression in transfected 293T cell line by FOSL1 polyclonal antibody.Lane 1: FOSL1 transfected lysate(29.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRA-1/FOSL1 Antibody Summary

Immunogen
FOSL1 (NP_005429.1, 1 a.a. - 271 a.a.) full-length human protein. MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOSL1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FRA-1/FOSL1 Antibody

  • FOSL1
  • FOS-like antigen 1
  • FOS-like antigen-1
  • fos-related antigen 1
  • FRA
  • FRA1
  • FRA-1

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for FRA-1/FOSL1 Antibody (H00008061-D01P) (0)

There are no publications for FRA-1/FOSL1 Antibody (H00008061-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRA-1/FOSL1 Antibody (H00008061-D01P) (0)

There are no reviews for FRA-1/FOSL1 Antibody (H00008061-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FRA-1/FOSL1 Antibody (H00008061-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FRA-1/FOSL1 Products

Bioinformatics Tool for FRA-1/FOSL1 Antibody (H00008061-D01P)

Discover related pathways, diseases and genes to FRA-1/FOSL1 Antibody (H00008061-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRA-1/FOSL1 Antibody (H00008061-D01P)

Discover more about diseases related to FRA-1/FOSL1 Antibody (H00008061-D01P).
 

Pathways for FRA-1/FOSL1 Antibody (H00008061-D01P)

View related products by pathway.

PTMs for FRA-1/FOSL1 Antibody (H00008061-D01P)

Learn more about PTMs related to FRA-1/FOSL1 Antibody (H00008061-D01P).
 

Research Areas for FRA-1/FOSL1 Antibody (H00008061-D01P)

Find related products by research area.

Blogs on FRA-1/FOSL1

There are no specific blogs for FRA-1/FOSL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRA-1/FOSL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOSL1
Entrez
Uniprot