FPRL1/FPR2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FPRL1/FPR2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FPR2.
  
  

  Source: E. coli

  Amino Acid Sequence: DTYCTFNFASWGGTPEERLKVAITMLTARG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FPR2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90180.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FPRL1/FPR2 Recombinant Protein Antigen

• ALXR
• FMLP-R-I
• FMLP-R-II
• FMLPX
• formyl peptide receptor 2
• Formyl peptide receptor-like 1RFP
• FPR2
• FPR2A
• FPRH1FMLP-related receptor I
• FPRL1
• FPRL1LXA4 receptor
• HM63
• HM63FPRH2
• lipoxin A4 receptor (formyl peptide receptor related)
• Lipoxin A4 receptor
• LXA4 Receptor
• LXA4RFMLP-R-I
• N-formyl peptide receptor 2
• RFP

Background

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for FPRL1/FPR2 Protein (NBP1-90180PEP). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
   • To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Bioinformatics

• Gene Symbol: FPR2