We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FPRL1/FPR2 Recombinant Protein Antigen

Images

 
There are currently no images for FPRL1/FPR2 Protein (NBP1-90180PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FPRL1/FPR2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FPR2.

Source: E. coli

Amino Acid Sequence: DTYCTFNFASWGGTPEERLKVAITMLTARG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FPR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90180.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FPRL1/FPR2 Recombinant Protein Antigen

  • ALXR
  • FMLP-R-I
  • FMLP-R-II
  • FMLPX
  • formyl peptide receptor 2
  • Formyl peptide receptor-like 1RFP
  • FPR2
  • FPR2A
  • FPRH1FMLP-related receptor I
  • FPRL1
  • FPRL1LXA4 receptor
  • HM63
  • HM63FPRH2
  • lipoxin A4 receptor (formyl peptide receptor related)
  • Lipoxin A4 receptor
  • LXA4 Receptor
  • LXA4RFMLP-R-I
  • N-formyl peptide receptor 2
  • RFP

Background

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3744
Species: Hu
Applications: CyTOF-ready, Flow
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP3-27172
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
H00084941-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-46214
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP3-06290
Species: Hu
Applications: IHC,  IHC-P
NBP1-89330
Species: Hu
Applications: IHC,  IHC-P
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-47405
Species: Hu
Applications: IHC,  IHC-P

Publications for FPRL1/FPR2 Protein (NBP1-90180PEP) (0)

There are no publications for FPRL1/FPR2 Protein (NBP1-90180PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPRL1/FPR2 Protein (NBP1-90180PEP) (0)

There are no reviews for FPRL1/FPR2 Protein (NBP1-90180PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FPRL1/FPR2 Protein (NBP1-90180PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
    • To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Additional FPRL1/FPR2 Products

Research Areas for FPRL1/FPR2 Protein (NBP1-90180PEP)

Find related products by research area.

Blogs on FPRL1/FPR2

There are no specific blogs for FPRL1/FPR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FPRL1/FPR2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FPR2