Recombinant Human FPRL1/FPR2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FPRL1/FPR2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 163-205 of Human FPRL1/FPR2

Source: Wheat Germ

Amino Acid Sequence: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FPR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
30.36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FPRL1/FPR2 Protein

  • ALXR
  • FMLP-R-I
  • FMLP-R-II
  • FMLPX
  • formyl peptide receptor 2
  • Formyl peptide receptor-like 1RFP
  • FPR2
  • FPR2A
  • FPRH1FMLP-related receptor I
  • FPRL1
  • FPRL1LXA4 receptor
  • HM63
  • HM63FPRH2
  • lipoxin A4 receptor (formyl peptide receptor related)
  • Lipoxin A4 receptor
  • LXA4 Receptor
  • LXA4RFMLP-R-I
  • N-formyl peptide receptor 2
  • RFP

Background

FPRL1 - formyl peptide receptor-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56473
Species: Hu, Mu, Pm
Applications: WB, Simple Western
MAB3896
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-52023
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-62539
Species: Hu
Applications: WB
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P

Publications for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01) (0)

There are no publications for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01) (0)

There are no reviews for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
    • To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Additional FPRL1/FPR2 Products

Bioinformatics Tool for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01)

Discover related pathways, diseases and genes to FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01)

Discover more about diseases related to FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01).
 

Pathways for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01)

View related products by pathway.

PTMs for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01)

Learn more about PTMs related to FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01).
 

Research Areas for FPRL1/FPR2 Partial Recombinant Protein (H00002358-Q01)

Find related products by research area.

Blogs on FPRL1/FPR2

There are no specific blogs for FPRL1/FPR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FPRL1/FPR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FPR2
Entrez