FPGT Antibody

Images

 
Western Blot: FPGT Antibody [H00008790-D01P] - Analysis of FPGT expression in mouse spleen.
Western Blot: FPGT Antibody [H00008790-D01P] - Analysis of FPGT expression in PC-12.
Western Blot: FPGT Antibody [H00008790-D01P] - Analysis of FPGT expression in human colon.
Western Blot: FPGT Antibody [H00008790-D01P] - Analysis of FPGT expression in transfected 293T cell line by FPGT polyclonal antibody.Lane 1: FPGT transfected lysate(66.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FPGT Antibody Summary

Immunogen
FPGT (NP_003829.2, 1 a.a. - 594 a.a.) full-length human protein. MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FPGT
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FPGT Antibody

  • fucose-1-phosphate guanyltransferase
  • fucose-1-phosphate guanylyltransferase
  • GDP-beta-L-fucose pyrophosphorylase
  • GDP-L-fucose diphosphorylase
  • GDP-L-fucose pyrophosphorylase
  • GFPPEC 2.7.7.30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB64091
Species: Hu
Applications: WB, ICC
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-59386
Species: Hu
Applications: WB
NBP1-83357
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37604
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00051086-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
MAB5756
Species: Hu
Applications: Flow
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00008790-D01P
Species: Hu, Mu, Rt
Applications: WB

Publications for FPGT Antibody (H00008790-D01P) (0)

There are no publications for FPGT Antibody (H00008790-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPGT Antibody (H00008790-D01P) (0)

There are no reviews for FPGT Antibody (H00008790-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FPGT Antibody (H00008790-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FPGT Products

Bioinformatics Tool for FPGT Antibody (H00008790-D01P)

Discover related pathways, diseases and genes to FPGT Antibody (H00008790-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FPGT Antibody (H00008790-D01P)

Discover more about diseases related to FPGT Antibody (H00008790-D01P).
 

Pathways for FPGT Antibody (H00008790-D01P)

View related products by pathway.

Blogs on FPGT

There are no specific blogs for FPGT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FPGT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FPGT
Uniprot