FOXO4 Recombinant Protein Antigen

Images

 
There are currently no images for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FOXO4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to FOXO4.

Source: E. coli

Amino Acid Sequence: GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOXO4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58083.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FOXO4 Recombinant Protein Antigen

  • AFX
  • AFX1myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 7
  • Fork head domain transcription factor AFX1
  • forkhead box O4
  • forkhead box protein O4
  • MLLT7MGC120490
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 7

Background

AFX aka FOXO4 is a forkhead transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. FOXO4 down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF1555
Species: Hu
Applications: WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB7557
Species: Hu
Applications: IHC, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NBP3-47436
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-76836
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-58083PEP
Species: Hu
Applications: AC

Publications for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP) (0)

There are no publications for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP) (0)

There are no reviews for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOXO4 Products

Research Areas for FOXO4 Recombinant Protein Antigen (NBP2-58083PEP)

Find related products by research area.

Blogs on FOXO4.

The role of HIF-1 Alpha signaling in the retina under hypoxic conditions
Hypoxia inducible factor 1 (HIF-1) is a protein that plays an essential role in hypoxia, or low levels of cellular oxygen. HIF-1 is a heterodimeric protein that consists of a constitutively expressed beta subunit and oxygen related alpha subunit.  ...  Read full blog post.

The Wise Old Fox: Forkhead Transcription Factors and Age-Related DAF-16 Studies
Orthologs are one of the classes of homolog genes. They occur in different species, but are linked by a common ancestral pathway. During evolution, they retain the same original function, irrespective of the species. Among the orthologs covered on our...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FOXO4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXO4