FOXO3 Antibody (1D2)

Images

 
Immunocytochemistry/ Immunofluorescence: FOXO3 Antibody (1D2) [H00002309-M06] - Analysis of monoclonal antibody to FOXO3 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: FOXO3 Antibody (1D2) [H00002309-M06] - Analysis of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml
ELISA: FOXO3 Antibody (1D2) [H00002309-M06] - Detection limit for recombinant GST tagged FOXO3A is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FOXO3 Antibody (1D2) Summary

Immunogen
FOXO3A (AAH21224 361 a.a. - 460 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS
Specificity
FOXO3A (1D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXO3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXO3 Antibody (1D2)

  • AF6q21 protein
  • AF6q21
  • DKFZp781A0677
  • FKHRL1
  • FKHRL1MGC31925
  • FKHRL1P2
  • forkhead box O3
  • forkhead box protein O3
  • forkhead homolog (rhabdomyosarcoma) like 1
  • Forkhead in rhabdomyosarcoma-like 1
  • forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1
  • FOXO2
  • FoxO3
  • FOXO3A
  • FOXO3Aforkhead box O3A
  • MGC12739

Background

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45712
Species: Hu
Applications: WB, IHC
AF1555
Species: Hu
Applications: WB
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FOXO3 Antibody (H00002309-M06) (0)

There are no publications for FOXO3 Antibody (H00002309-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXO3 Antibody (H00002309-M06) (0)

There are no reviews for FOXO3 Antibody (H00002309-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOXO3 Antibody (H00002309-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXO3 Products

Bioinformatics Tool for FOXO3 Antibody (H00002309-M06)

Discover related pathways, diseases and genes to FOXO3 Antibody (H00002309-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXO3 Antibody (H00002309-M06)

Discover more about diseases related to FOXO3 Antibody (H00002309-M06).
 

Pathways for FOXO3 Antibody (H00002309-M06)

View related products by pathway.

PTMs for FOXO3 Antibody (H00002309-M06)

Learn more about PTMs related to FOXO3 Antibody (H00002309-M06).
 

Research Areas for FOXO3 Antibody (H00002309-M06)

Find related products by research area.

Blogs on FOXO3

There are no specific blogs for FOXO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXO3 Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXO3
Entrez
OMIM
Uniprot