Novus Biologicals products are now on bio-techne.com

FOXI1 Antibody

Images

 
Western Blot: FOXI1 Antibody [H00002299-B02P] - Analysis of FOXI1 expression in transfected 293T cell line by FOXI1 polyclonal antibody. Lane 1: FOXI1 transfected lysate(31.13 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: FOXI1 Antibody [H00002299-B02P] - Analysis of purified antibody to FOXI1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FOXI1 Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
FOXI1 (NP_658982.1, 1 a.a. - 283 a.a.) full-length human protein. MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV
Specificity
FOXI1 - forkhead box I1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FOXI1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXI1 Antibody

  • FKHL10HFH3
  • forkhead box I1
  • forkhead box protein I1
  • forkhead-like 10
  • forkhead-related activator 6
  • Forkhead-related protein FKHL10
  • Forkhead-related transcription factor 6
  • FREAC-6
  • FREAC6FKH10
  • Hepatocyte nuclear factor 3 forkhead homolog 3
  • HFH-3
  • HNF-3/fork-head homolog 3
  • HNF-3/fork-head homolog-3
  • MGC34197

Background

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3619
Species: Hu
Applications: ICC, Simple Western, WB
1206-F3
Species: Hu
Applications: BA
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
AF3975
Species: Hu
Applications: ICC, WB
NBP1-32440
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, Single-Cell Western, WB
423-F8
Species: Hu, Mu
Applications: BA
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4218
Species: Hu
Applications: IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45736
Species: Hu
Applications: IHC, IHC-P, WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-85385
Species: Hu, Mu
Applications: WB
NBP3-10932
Species: Hu
Applications: IHC, WB
H00002298-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-1268
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB
NB300-925
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF4798
Species: Hu
Applications: WB

Publications for FOXI1 Antibody (H00002299-B02P) (0)

There are no publications for FOXI1 Antibody (H00002299-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXI1 Antibody (H00002299-B02P) (0)

There are no reviews for FOXI1 Antibody (H00002299-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOXI1 Antibody (H00002299-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXI1
Entrez
Uniprot