FOXD2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the c terminal region of mouse FOXD2. Peptide sequence: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FOXD2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for FOXD2 Antibody - BSA Free
Background
FOXD2 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, PEP-ELISA
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: WB
Publications for FOXD2 Antibody (NBP2-84025) (0)
There are no publications for FOXD2 Antibody (NBP2-84025).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FOXD2 Antibody (NBP2-84025) (0)
There are no reviews for FOXD2 Antibody (NBP2-84025).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FOXD2 Antibody (NBP2-84025) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FOXD2 Products
Blogs on FOXD2