FOXA3 Antibody (1C6)


Sandwich ELISA: FOXA3 Antibody (1C6) [H00003171-M01] - Detection limit for recombinant GST tagged FOXA3 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

FOXA3 Antibody (1C6) Summary

FOXA3 (NP_004488.2, 266 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Reacts with forkhead box A3.
IgG1 Kappa
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
Protein A purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXA3 Antibody (1C6)

  • FKHH3
  • Fork head-related protein FKH H3
  • forkhead box A3
  • Forkhead box protein A3
  • hepatocyte nuclear factor 3, gamma
  • hepatocyte nuclear factor 3-gamma
  • HNF-3G
  • HNF-3-gamma
  • MGC10179
  • TCF3G
  • Transcription factor 3G


This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA

Publications for FOXA3 Antibody (H00003171-M01) (0)

There are no publications for FOXA3 Antibody (H00003171-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXA3 Antibody (H00003171-M01) (0)

There are no reviews for FOXA3 Antibody (H00003171-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXA3 Antibody (H00003171-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FOXA3 Products

Bioinformatics Tool for FOXA3 Antibody (H00003171-M01)

Discover related pathways, diseases and genes to FOXA3 Antibody (H00003171-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXA3 Antibody (H00003171-M01)

Discover more about diseases related to FOXA3 Antibody (H00003171-M01).

Pathways for FOXA3 Antibody (H00003171-M01)

View related products by pathway.

PTMs for FOXA3 Antibody (H00003171-M01)

Learn more about PTMs related to FOXA3 Antibody (H00003171-M01).

Research Areas for FOXA3 Antibody (H00003171-M01)

Find related products by research area.

Blogs on FOXA3

There are no specific blogs for FOXA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FOXA3 Antibody (1C6) and receive a gift card or discount.


Gene Symbol FOXA3