FOPNL Antibody

Images

 
Western Blot: FOPNL Antibody [NBP1-84109] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: FOPNL Antibody [NBP1-84109] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: FOPNL Antibody [NBP1-84109] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOPNL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOPNL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FOPNL Protein (NBP1-84109PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FOPNL Antibody

  • C16orf63
  • chromosome 16 open reading frame 63
  • DKFZp686N1651
  • FGFR1OP N-terminal like
  • FGFR1OP N-terminal-like protein
  • FLJ31153
  • FOP-related protein of 20 kDa
  • FOR20
  • lisH domain-containing protein C16orf63
  • PHSECRG2pluripotent embryonic stem cell-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4524
Species: Rt
Applications: WB
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-88085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93773
Species: Hu
Applications: WB, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84109
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FOPNL Antibody (NBP1-84109) (0)

There are no publications for FOPNL Antibody (NBP1-84109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOPNL Antibody (NBP1-84109) (0)

There are no reviews for FOPNL Antibody (NBP1-84109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOPNL Antibody (NBP1-84109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOPNL Products

Bioinformatics Tool for FOPNL Antibody (NBP1-84109)

Discover related pathways, diseases and genes to FOPNL Antibody (NBP1-84109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FOPNL

There are no specific blogs for FOPNL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOPNL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOPNL