FNBP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FNBP4 Antibody [NBP2-14021] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: FNBP4 Antibody [NBP2-14021] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FNBP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STQTSGWQYDTQCSLAGVGIEMGDWQEVWDENTGCYYYWNTQTNEVTWEL PQYLATQVQGLQHYQPSSVPGAETSFVVNT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNBP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
FNBP4 Protein (NBP2-14021PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FNBP4 Antibody

  • DKFZp686M14102
  • FBP30
  • FLJ41904
  • formin binding protein 4
  • Formin-binding protein 30
  • formin-binding protein 4
  • KIAA1014DKFZp779I1064

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
MAB7670
Species: Hu
Applications: WB, ICC

Publications for FNBP4 Antibody (NBP2-14021) (0)

There are no publications for FNBP4 Antibody (NBP2-14021).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNBP4 Antibody (NBP2-14021) (0)

There are no reviews for FNBP4 Antibody (NBP2-14021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FNBP4 Antibody (NBP2-14021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FNBP4 Products

Bioinformatics Tool for FNBP4 Antibody (NBP2-14021)

Discover related pathways, diseases and genes to FNBP4 Antibody (NBP2-14021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNBP4 Antibody (NBP2-14021)

Discover more about diseases related to FNBP4 Antibody (NBP2-14021).
 

Pathways for FNBP4 Antibody (NBP2-14021)

View related products by pathway.

PTMs for FNBP4 Antibody (NBP2-14021)

Learn more about PTMs related to FNBP4 Antibody (NBP2-14021).

Blogs on FNBP4

There are no specific blogs for FNBP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FNBP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNBP4