FLVCR Antibody (4B2) - Azide and BSA Free

Western Blot: FLVCR Antibody (4B2) [H00028982-M05] - Analysis of FLVCR expression in transfected 293T cell line by FLVCR monoclonal antibody (M05), clone 4B2. Lane 1: FLVCR transfected lysatE (59.9 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: FLVCR Antibody (4B2) [H00028982-M05] - Detection limit for recombinant GST tagged FLVCR1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Flow, KD
• Clone: 4B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FLVCR Antibody (4B2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FLVCR Antibody (4B2) - Azide and BSA Free (H00028982-M05) is a monoclonal antibody validated for use in WB, ELISA and Flow. Anti-FLVCR Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
• Specificity: FLVCR - feline leukemia virus subgroup C cellular receptor
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FLVCR1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Flow Cytometry
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FLVCR Antibody (4B2) - Azide and BSA Free

• ataxia, posterior column 1, with retinitis pigmentosa
• AXPC1
• feline leukemia virus subgroup C cellular receptor 1
• Feline leukemia virus subgroup C receptor
• feline leukemia virus subgroup C receptor-related protein 1
• FLVCRFLJ33420
• hFLVCR
• MFSD7B
• PCA
• PCARP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLVCR Antibody (H00028982-M05)(1)

Publication using H00028982-M05

• Alves LR, Costa ES, Sorgine MH et al. Heme-Oxygenases during Erythropoiesis in K562 and Human Bone Marrow Cells. PLoS One. 2011-07-13 [PMID: 21765894]

Bioinformatics

• Gene Symbol: FLVCR1
• Entrez:
  • 28982(Human)
• OMIM:
  • 609144(Human)
• Uniprot:
  • NP_054772(Human)