Flt-3 Ligand Antibody

Images

 
Western Blot: Flt-3 Ligand Antibody [H00002323-D01P] - Analysis of FLT3LG expression in transfected 293T cell line by FLT3LG polyclonal antibody.Lane 1: FLT3LG transfected lysate(26.40 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Flt-3 Ligand Antibody Summary

Immunogen
FLT3LG (NP_001450.2, 1 a.a. - 235 a.a.) full-length human protein. MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLT3LG
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Flt-3 Ligand Antibody

  • FL
  • Flt3 ligand
  • Flt-3 Ligand
  • Flt3L
  • FLT3LG
  • fms-related tyrosine kinase 3 ligand
  • SL cytokine

Background

Human Flt3 ligand (Flt3L) stimulates early hematopoiesis by activating a type III tyrosine kinase receptor on primitive bone marrow stem cells. The crystal structure of soluble Flt3L reveals that it is a homodimer of two short chain alpha-helical bundles (1). Flt3 is a hematopoietic growth factor that stimulates cells via specific and structurally related tyrosine kinase receptors on the cell surface (2). This growth factor stimulated the proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for Flt-3 Ligand Antibody (H00002323-D01P) (0)

There are no publications for Flt-3 Ligand Antibody (H00002323-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3 Ligand Antibody (H00002323-D01P) (0)

There are no reviews for Flt-3 Ligand Antibody (H00002323-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flt-3 Ligand Antibody (H00002323-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Flt-3 Ligand Products

Bioinformatics Tool for Flt-3 Ligand Antibody (H00002323-D01P)

Discover related pathways, diseases and genes to Flt-3 Ligand Antibody (H00002323-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flt-3 Ligand Antibody (H00002323-D01P)

Discover more about diseases related to Flt-3 Ligand Antibody (H00002323-D01P).
 

Pathways for Flt-3 Ligand Antibody (H00002323-D01P)

View related products by pathway.

PTMs for Flt-3 Ligand Antibody (H00002323-D01P)

Learn more about PTMs related to Flt-3 Ligand Antibody (H00002323-D01P).
 

Research Areas for Flt-3 Ligand Antibody (H00002323-D01P)

Find related products by research area.

Blogs on Flt-3 Ligand

There are no specific blogs for Flt-3 Ligand, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flt-3 Ligand Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT3LG
Entrez
Uniprot