FLJ21908 Recombinant Protein Antigen

Images

 
There are currently no images for FLJ21908 Protein (NBP1-89850PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FLJ21908 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPAP3.

Source: E. coli

Amino Acid Sequence: SEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMFM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPAP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89850.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FLJ21908 Recombinant Protein Antigen

  • FLJ21908
  • RNA polymerase II associated protein 3
  • RNA polymerase II-associated protein 3
  • spag

Background

FLJ21908, also known as RNA polymerase II associated protein, has a 665 amino acid isoform that is 76 kDa, a 631 amino acid isoform that is 72 kDa, and a 506 amino acid isoform that is 57 kDa; is involved in formation of an interface between the RNA polymerase II enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. Disease research suggests correlation of this protein with sickle cell trait and malaria. This protein has interactions with HSP90AA1, HSP90AB1, MAP3K3, ITCH, PPP1CA, POLR2A, HELLS, WDR92 and TEL02.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40354
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-92594
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NBP1-92269
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-56122
Species: Hu
Applications: ICC/IF
AF640
Species: Mu
Applications: IHC, WB
NBP1-80694
Species: Hu
Applications: ICC/IF, WB
NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-81761
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
H00023049-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-14512
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for FLJ21908 Protein (NBP1-89850PEP) (0)

There are no publications for FLJ21908 Protein (NBP1-89850PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ21908 Protein (NBP1-89850PEP) (0)

There are no reviews for FLJ21908 Protein (NBP1-89850PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FLJ21908 Protein (NBP1-89850PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FLJ21908 Products

Blogs on FLJ21908

There are no specific blogs for FLJ21908, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FLJ21908 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPAP3