Home » FLJ21908 » FLJ21908 Proteins » FLJ21908 Recombinant Protein Antigen

FLJ21908 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FLJ21908 Protein (NBP1-89849PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FLJ21908 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPAP3.

Source: E.coli

Amino Acid Sequence: ERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANAL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPAP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89849.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FLJ21908 Recombinant Protein Antigen

  • FLJ21908
  • RNA polymerase II associated protein 3
  • RNA polymerase II-associated protein 3
  • spag

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUVBL2 Antibody
NBP1-40354
Western Blot: RUVBL2 Antibody [NBP1-40354] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-RuvBL2 antibody used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 10 mcg/mg lysate. RuvBL2 was also immunoprecipitated by rabbit anti-RuvBL2 antibody NBP1-40355 which recognizes a downstream epitope.
Immunohistochemistry-Paraffin: RUVBL2 Antibody [NBP1-40354] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- RuvBL2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(1 Review)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(518 Publications)
Species: Hu
WDR92 Antibody
NBP1-92594
Western Blot: WDR92 Antibody [NBP1-92594] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: WDR92 Antibody [NBP1-92594] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: WDR92 Antibody [NBP1-92594] - Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB as shown by EMSA. U266 cells were treated with 100 uM of control or NBD peptide for different time periods. Nuclear extracts were isolated and checked for NF-kB-DNA binding activity.
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB activation in human multiple myeloma cells. U266 cells were treated with 100 uM of control (A & B) or NBD peptide (C & D) for 12 hr, cytospun, plated on glass slides, air dried for 1 hr at room temperature and fixed with cold acetone. Slides were blocked with 5% normal goat serum for 1 hr and then incubated with rabbit polyclonal anti-human p65 antibody (A & C) followed by Ig-Alexa 594 second step. In control peptide treated cells, p65 translocates to nucleus (A), whereas NBD peptide prevents translocation of p65 into the nucleus (C). B & D: Nuclear staining with DNA binding dye.
IKK gamma Inhibitor Peptide Set [NBP2-26504] - The IKK complex consists of IKKalpha + IKKbeta+ NEMO. NEMO (IKKgamma/NF-kB Essential MOdulator) is a scaffold protein required for the kinase activity of IKKalpha + IKKbeta. NBD (NEMO Binding Domain) inhibits formation of the IKK complex (IKKalpha + IKKbeta+ NEMO) by binding to NEMO and blocking IKK complex formation. In this regard, NBD is considered to be an 'IKKalpha and IKKBeta decoy' Blocking IKK complex formation suppresses downstream events in the NF-kB signaling pathway that rely on the IKK complex including phosphorylation of IkBalpha, and subsequence IkBalpha ubiquination, degradation and release of NF-kB. Hence, NF-kB is retained in the cytoplasm in its inactive state.
(22 Publications)
Species: Hu, Mu, Rt
gamma H2AX [p
Ser139] Antibody
NB100-384
Immunocytochemistry/Immunofluorescence: gamma H2AX [p Ser139] Antibody [NB100-384] - Samples: Neocarzinostatin treated asynchronous HeLa cells (left) and untreated asynchronous HeLa cells (right). Antibody: Affinity purified rabbit anti-gamma-H2AX used at a dilution of 1:5,000 (0.2ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight 594 used at a dilution of 1:100.
Flow Cytometry: gamma H2AX [p Ser139] Antibody [NB100-384] - Analysis of gamma-H2AX in Etoposide Treated Jurkat Cells. Cells were treated for 3 hrs in 5ug/ml etoposide, fixed in 1.5% PFA, and permeabilized in 90% Methanol. 1 million cells were stained with 0.5 ug anti-KLH or anti-H2AX NB100-384 and secondary FITC-conjugated goat anti-rabbit (in a 150ul reaction). Black- etosposide treated, anti-KLH; Red- untreated, anti-gamma H2AX; Blue- etoposide treated, anti-gamma H2AX.
Western Blot: gamma H2AX [p Ser139] Antibody [NB100-384] - Samples: Nuclear extract from HeLa cells treated with 100 uM etoposide for 4 hours (+) or mock treated (-). Antibody: Affinity purified rabbit anti-gamma-H2AX antibody used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(70 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(115 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
PIH1D1 Antibody
NBP1-92269
Western Blot: PIH1D1 Antibody [NBP1-92269] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunocytochemistry/Immunofluorescence: PIH1D1 Antibody [NBP1-92269] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PIH1D1 Antibody [NBP1-92269] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
POLR1A Antibody
NBP2-56122
Immunocytochemistry/Immunofluorescence: POLR1A Antibody [NBP2-56122] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
EphA3
640-A3
EphA3
(5 Publications)
Species: Mu
ETV7 Antibody
NBP1-80694
Western Blot: ETV7 Antibody [NBP1-80694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ETV7 Antibody [NBP1-80694] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ETV7 Antibody [NBP1-80694] - Staining of human bone marrow shows strong nuclear positivity in subsets of bone marrow poietic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
POLR2C Antibody
NBP2-19885
Western Blot: POLR2C Antibody [NBP2-19885] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP2-19885] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: POLR2C protein stained by POLR2C antibody [N1C3-2] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: POLR2C Antibody [NBP2-19885] - Paraffin-embedded mouse liver. POLR2C antibody [N1C3-2] dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunohistochemistry-Paraffin: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of a formalin fixed paraffin embedded tissue section of human brain (Alzheimers disease, hippocampus) using 1:200 dilution of anti-beta Amyloid antibody (clone MOAB-2). The staining was developed with HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This beta Amyloid antibody specifically stained the cells with Abeta 42/ Abeta aggregates while the normal cells were negative for abeta peptide.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(12 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AAAS Antibody (5A1)
H00008086-M02
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in NIH/3T3.
Immunohistochemistry-Paraffin: AAAS Antibody (5A1) [H00008086-M02] - Analysis of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Western Blot analysis of AAAS expression in HeLa ( Cat # L013V1 ).
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
TEL2 Antibody
NBP1-81761
Western Blot: TEL2 Antibody [NBP1-81761] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: TEL2 Antibody [NBP1-81761] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: TEL2 Antibody [NBP1-81761] - Staining of human urinary bladder shows cytoplasmic and nuclear positivity in urothelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATR Antibody (2B5)
NB100-308
Western Blot: ATR Antibody (2B5) [NB100-308] - Human Raji whole cell extract. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
(17 Publications)
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
SMG1 Antibody
NB100-2320
Western Blot: SMG1 Antibody [NB100-2320] - Detection of Human SMG1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SMG1 antibody NB100-2320 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: SMG1 Antibody [NB100-2320] - Detection of Human SMG1 on HeLa whole cell lysate using NB100-2320. IP of SMG1 was successful when using affinity purified rabbit anti-SMG1 antibodies NB100-2321 and another SMG1 antibody.
(3 Publications)
Species: Hu
Applications: IP (-), WB, IP
RPAP1 Antibody
NBP2-14512
Immunocytochemistry/Immunofluorescence: RPAP1 Antibody [NBP2-14512] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPAP1 Antibody [NBP2-14512] - Staining of human colon shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
Immunohistochemistry: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Used at 5 ug/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate staining of proximal convoluted tubules of the kidney. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain.
(5 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for FLJ21908 Protein (NBP1-89849PEP) (0)

There are no publications for FLJ21908 Protein (NBP1-89849PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ21908 Protein (NBP1-89849PEP) (0)

There are no reviews for FLJ21908 Protein (NBP1-89849PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FLJ21908 Protein (NBP1-89849PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FLJ21908 Protein (NBP1-89849PEP)

Discover related pathways, diseases and genes to FLJ21908 Protein (NBP1-89849PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ21908 Protein (NBP1-89849PEP)

Discover more about diseases related to FLJ21908 Protein (NBP1-89849PEP).
 

Pathways for FLJ21908 Protein (NBP1-89849PEP)

View related products by pathway.

PTMs for FLJ21908 Protein (NBP1-89849PEP)

Learn more about PTMs related to FLJ21908 Protein (NBP1-89849PEP).

Blogs on FLJ21908

There are no specific blogs for FLJ21908, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human FLJ21908 Protein
H00079657-P01-2ug
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: FLJ21908 Antibody [NBP1-89850] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
FLJ21908 Antibody
NBP1-89850
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Caspase-3 Antibody (31A1067) - (Pro and Active)
NB100-56708

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FLJ21908 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RPAP3