Home » FKBP9 » FKBP9 Antibodies » FKBP9 Antibody

FKBP9 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FKBP9 Antibody [NBP1-83887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: FKBP9 Antibody [NBP1-83887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FKBP9 Antibody [NBP1-83887] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human placenta shows strong granular cytoplasmic positivity in in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FKBP9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP9 Protein (NBP1-83887PEP)
Publications
Read Publication using
NBP1-83887 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP9 Antibody

  • 63 kDa FK506-binding protein
  • DKFZp586B1723
  • FK506 binding protein 9, 63 kDa
  • FKBP60
  • FKBP63
  • FKBP-9
  • MGC126772,63 kDa FKBP
  • MGC138258
  • peptidyl-prolyl cis-trans isomerase FKBP9
  • PPIase
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclophilin A
Antibody
NBP1-30993
Western Blot: Cyclophilin A Antibody [NBP1-30993] - Analysis. Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody at a dilution of 1:20000.
Western Blot: Cyclophilin A Antibody [NBP1-30993] - (30 ug of whole cell lysate) A: HepG2 12% SDS PAGE diluted at 1:3000
Knockdown Validated: Cyclophilin A Antibody [NBP1-30993] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody diluted at 1:20000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PPIL1 Antibody
NBP3-00253
Immunohistochemistry-Paraffin: PPIL1 Antibody [NBP3-00253] - Immunochemical staining of human PPIL1 in human epididymis with rabbit polyclonal antibody (1:5000, formalin-fixed paraffin embedded sections).
Western Blot: PPIL1 Antibody [NBP3-00253] - Anti-PPIL1 rabbit polyclonal antibody at 1:500 dilution. Lane A: U87-MG Whole Cell Lysate. Lane B: Hela Whole Cell Lysate. Lane C: K562 Whole Cell Lysate. Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 18 kDa. Observed band size: 17 kDa
Immunoprecipitation: PPIL1 Antibody [NBP3-00253] - PPIL1 was immunoprecipitated using: Lane A: 0.5 mg HepG2 Whole Cell Lysate 2 ul anti-PPIL1 rabbit polyclonal antibody and 15 ul of 50 % Protein G agarose. Primary antibody: Anti-PPIL1 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Dylight 800-labeled antibody to rabbit IgG (H+L), at 1:5000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 18 kDa. Observed band size: 18 kDa
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Cyclophilin A
Antibody
NBP1-30993
Western Blot: Cyclophilin A Antibody [NBP1-30993] - Analysis. Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody at a dilution of 1:20000.
Western Blot: Cyclophilin A Antibody [NBP1-30993] - (30 ug of whole cell lysate) A: HepG2 12% SDS PAGE diluted at 1:3000
Knockdown Validated: Cyclophilin A Antibody [NBP1-30993] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Cyclophilin A antibody diluted at 1:20000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
FKBP12 Antibody
(422513)
MAB3777
Western blot shows lysates of Neuro-2A mouse neuroblastoma cell line, Jurkat human acute T cell leukemia cell line, and MCF-7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL Rat Anti-Human/Mouse/Rat FKBP12 Monoclonal Antibody (Catalog # MAB3777) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). For additional reference, Recombinant Human FKBP12 (Catalog # 3777-FK), recombinant human FKBP12.6, and recombinant human FKBP13 (5 ng/lane) were included. A specific band for FKBP12 was detected at approximately 12 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
PDZD2/PDZK3
Antibody (787924)
MAB7670
Western blot shows lysates of human prostate tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PDZD2 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PDZD2 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, WB
Pin1 Antibody
(257417) [Unconjugate
MAB2294
Western blot shows lysates of Balb/3T3 mouse embryonic fibroblast cell line, U2OS human osteosarcoma cell line, HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Pin1 at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Pin1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 8 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Pin1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in NIH/3T3.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western blot shows lysates of DU145 human prostate carcinoma cell line. PVDF membrane was probed with 0.3 µg/mL of Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for FKBP51 at approximately 51 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of DU145 human prostate carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for FKBP51 at approximately 61 kDa (as indicated) using 3 µg/mL of Goat Anti-Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
FKBP51 was detected in immersion fixed paraffin-embedded sections of human prostate using 15 µg/mL Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Cyclophilin 40
Antibody
NBP1-85364
Western Blot: Cyclophilin 40 Antibody [NBP1-85364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody [NBP1-85364] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: Cyclophilin 40 Antibody [NBP1-85364] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PPIG Antibody (4F8)
H00009360-M02
Immunocytochemistry/Immunofluorescence: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: PPIG Antibody (4F8) [H00009360-M02] - Detection limit for recombinant GST tagged PPIG is approximately 0.1ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Cyclophilin C
Antibody (3C6) - BSA
NBP1-97946
Western Blot: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis in HeLa, 1:1000 dilution.
Flow Cytometry: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis of PPIC in HeLa cell line, staining at 2-5ug for 1x106cells (red line). The secondary antibody used goat anti-mouse IgG Alexa fluor 488 conjugate. Isotype control antibody was mouse IgG (black line).
Immunocytochemistry/Immunofluorescence: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis in HeLa cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human PPIC antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
FKBP13/FKBP2
Antibody
NBP2-38604
Immunocytochemistry/Immunofluorescence: FKBP13/FKBP2 Antibody [NBP2-38604] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: FKBP13/FKBP2 Antibody [NBP2-38604] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: FKBP13/FKBP2 Antibody [NBP2-38604] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MIPEP Antibody
(OTI5E7)
NBP2-45861
Flow Cytometry: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by MIPEP antibody.
Immunofluorescence: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY MIPEP.
Immunohistochemistry: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of Human prostate tissue.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
Aquaporin-0
Antibody
NBP2-92773
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Human stomach using MIP antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Mouse brain using MIP antibody at dilution of 1:100 (40x lens).
Western Blot: Aquaporin-0 Antibody [NBP2-92773] - Analysis of extracts of various cell lines, using Aquaporin-0 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela C: Hep G2 D: Molt-4 12% SDS PAGE; antibody diluted at 1:10000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Transportin 1
Antibody (D45) - BSA
NB600-1397
Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Human lung cancer cell line usig lysates from HCC44 cell line. (N: Nuclear fraction, C: Cytoplasmic fraction). Image from verified customer review.
Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Whole cell protein from A431, Hek293 and MCF7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Transportin 1 (D45) in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: Transportin 1 Antibody (D45) [NB600-1397] - IHC analysis of a formalin fixed paraffin embedded tissue section of human pancreas using Transportin 1 antibody (clone D45) at 1:200 dilution. The antibody generated specific nuclear and cytoplasmic signal of Transportin 1 protein in the glandular cells while the connective tissue was largely negative.
(1 Review)
(6 Publications)
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
PPIL2 Antibody
NBP1-85360
Immunohistochemistry-Paraffin: PPIL2 Antibody [NBP1-85360] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Western Blot: PPIL2 Antibody [NBP1-85360] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: PPIL2 Antibody [NBP1-85360] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cyclophilin-F
Antibody
NBP2-15079
Knockout Validated: Cyclophilin-F Antibody [NBP2-15079] - Wild-type (WT) and Cyclophilin F knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Cyclophilin-F antibody diluted at 1:5000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cyclophilin-F Antibody [NBP2-15079] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Western Blot: Cyclophilin-F Antibody [NBP2-15079] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with Cyclophilin F antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
FKBP9 Antibody
NBP1-83887
FKBP9 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FKBP9 Antibody (NBP1-83887)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FKBP9 Antibody (NBP1-83887) (0)

There are no reviews for FKBP9 Antibody (NBP1-83887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP9 Antibody (NBP1-83887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP9 Products

Bioinformatics Tool for FKBP9 Antibody (NBP1-83887)

Discover related pathways, diseases and genes to FKBP9 Antibody (NBP1-83887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP9 Antibody (NBP1-83887)

Discover more about diseases related to FKBP9 Antibody (NBP1-83887).

PTMs for FKBP9 Antibody (NBP1-83887)

Learn more about PTMs related to FKBP9 Antibody (NBP1-83887).

Blogs on FKBP9

There are no specific blogs for FKBP9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FKBP9