Home » FKBP9 » FKBP9 Antibodies » FKBP9 Antibody

FKBP9 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FKBP9 Antibody [NBP1-83887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: FKBP9 Antibody [NBP1-83887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FKBP9 Antibody [NBP1-83887] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human placenta shows strong granular cytoplasmic positivity in in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FKBP9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF
Specificity
Specificity of human FKBP9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP9 Protein (NBP1-83887PEP)
Publications
Read Publication using
NBP1-83887 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP9 Antibody

  • 63 kDa FK506-binding protein
  • DKFZp586B1723
  • FK506 binding protein 9, 63 kDa
  • FKBP60
  • FKBP63
  • FKBP-9
  • MGC126772,63 kDa FKBP
  • MGC138258
  • peptidyl-prolyl cis-trans isomerase FKBP9
  • PPIase
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclophilin A
Antibody [Unconjugate
AF3589
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C2C12 mouse myoblast cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclophilin A at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclophilin A at approximately 25 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Cyclophilin A was detected in immersion fixed PANC-1 human pancreatic carcinoma cell line using Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
PPIL1 Antibody
NBP3-00253
Western Blot: PPIL1 Antibody [NBP3-00253] - Anti-PPIL1 rabbit polyclonal antibody at 1:500 dilution. Lane A: U87-MG Whole Cell Lysate. Lane B: Hela Whole Cell Lysate. Lane C: K562 Whole Cell Lysate. Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 18 kDa. Observed band size: 17 kDa
Immunohistochemistry-Paraffin: PPIL1 Antibody [NBP3-00253] - Immunochemical staining of human PPIL1 in human epididymis with rabbit polyclonal antibody (1:5000, formalin-fixed paraffin embedded sections).
Immunoprecipitation: PPIL1 Antibody [NBP3-00253] - PPIL1 was immunoprecipitated using: Lane A: 0.5 mg HepG2 Whole Cell Lysate 2 ul anti-PPIL1 rabbit polyclonal antibody and 15 ul of 50 % Protein G agarose. Primary antibody: Anti-PPIL1 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Dylight 800-labeled antibody to rabbit IgG (H+L), at 1:5000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 18 kDa. Observed band size: 18 kDa
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Cyclophilin A
Antibody [Unconjugate
AF3589
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C2C12 mouse myoblast cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclophilin A at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclophilin A at approximately 25 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Cyclophilin A was detected in immersion fixed PANC-1 human pancreatic carcinoma cell line using Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
FKBP12 Antibody
NB300-508
Western Blot: FKBP12 Antibody [NB300-508] - Analysis of purified FKBP12 after immunoprecipatation on a 15% gel.
Immunohistochemistry-Paraffin: FKBP12 Antibody [NB300-508] - Both normal and cancer biopsies of deparaffinized human Colon carcinoma tissue.
Immunohistochemistry-Paraffin: FKBP12 Antibody [NB300-508] - Both normal and cancer biopsies of deparaffinized human Heart tissue.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
PDZD2/PDZK3
Antibody (787924)
MAB7670
Western blot shows lysates of human prostate tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PDZD2 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PDZD2 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
Pin1 Antibody
(257417) [Unconjugate
MAB2294
Western blot shows lysates of Balb/3T3 mouse embryonic fibroblast cell line, U2OS human osteosarcoma cell line, HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Pin1 at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Pin1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 8 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Pin1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Mouse Anti-Human/Mouse Pin1 Monoclonal Antibody (Catalog # MAB2294) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: WB, IHC, IP, ICC
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in NIH/3T3.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11 Analysis of FKBP4 expression in HeLa.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western blot shows lysates of DU145 human prostate carcinoma cell line. PVDF membrane was probed with 0.3 µg/mL of Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for FKBP51 at approximately 51 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of DU145 human prostate carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for FKBP51 at approximately 61 kDa (as indicated) using 3 µg/mL of Goat Anti-Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and FKBP51 knockout HeLa cell line (KO). PVDF membrane was probed with 0.3 µg/mL of Goat Anti-Human/Mouse/Rat FKBP51 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4094) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for FKBP51 at approximately 32 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Cyclophilin 40
Antibody
NB120-3562
Western Blot: Cyclophilin 40 Antibody [NB120-3562] - Analysis of rat spleen extracts.
Immunocytochemistry/Immunofluorescence: Cyclophilin 40 Antibody [NB120-3562] - Analysis of Cyclophilin D in HepG2 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a Cyclophilin D polyclonal antibody at a dilution of 1:200 overnight at 4C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody. Cyclophilin D staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody [NB120-3562] - Both normal and cancer biopsies of deparaffinized human Hepatocarcinoma tissue.
(1 Publication)
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
PPIG Antibody (4F8)
H00009360-M02
Immunocytochemistry/Immunofluorescence: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: PPIG Antibody (4F8) [H00009360-M02] - Detection limit for recombinant GST tagged PPIG is approximately 0.1ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
HSP90 alpha
Antibody
NBP1-77685
Western Blot: HSP90 alpha Antibody [NBP1-77685] - Analysis of HSP901a in 1: HeLa. 2: Ntera2. 3: A431. 4: HepG2. 5: MCF7. 6: NIH/3T3. 7: PC12. 8: COS7.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Cyclophilin C
Antibody (3C6)
NBP1-97946
Western Blot: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis in HeLa, 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis in HeLa cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human PPIC antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Flow Cytometry: Cyclophilin C Antibody (3C6) [NBP1-97946] - Analysis of PPIC in HeLa cell line, staining at 2-5ug for 1x106cells (red line). The secondary antibody used goat anti-mouse IgG Alexa fluor 488 conjugate. Isotype control antibody was mouse IgG (black line).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
FKBP13/FKBP2
Antibody
NBP2-38604
Western Blot: FKBP13/FKBP2 Antibody [NBP2-38604] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: FKBP13/FKBP2 Antibody [NBP2-38604] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: FKBP13/FKBP2 Antibody [NBP2-38604] - Staining in human epididymis and skeletal muscle tissues using anti-FKBP2 antibody. Corresponding FKBP2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MIPEP Antibody
(OTI5E7)
NBP2-45861
Western Blot: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MIPEP.
Immunohistochemistry: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of Carcinoma of Human thyroid tissue.
Flow Cytometry: MIPEP Antibody (OTI5E7) [NBP2-45861] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by MIPEP antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IF
Aquaporin-0
Antibody
NBP2-92773
Western Blot: Aquaporin-0 Antibody [NBP2-92773] - Analysis of extracts of various cell lines, using Aquaporin-0 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Paraffin-embedded rat brain using Aquaporin-0.
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Paraffin-embedded human stomach using Aquaporin-0.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - A. 30 ug Neuro2A whole cell lysate/extract. B. 30 ug GL261 whole cell lysate/extract. C. 30 ug C8D30 whole cell lysate/extract. D. 30 ug NIH-3T3 whole cell lysate/extract. E. 30 ug BCL-1 whole cell lysate/extract. F. 30 ug Raw264.7 whole cell lysate/extract. G. 30 ug C2C12 whole cell lysate/extract.
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Transportin 1
Antibody (D45)
NB600-1397
Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Human lung cancer cell line usig lysates from HCC44 cell line. (N: Nuclear fraction, C: Cytoplasmic fraction). Image from verified customer review.
Immunohistochemistry-Paraffin: Transportin 1 Antibody (D45) [NB600-1397] - IHC analysis of a formalin fixed paraffin embedded tissue section of human pancreas using Transportin 1 antibody (clone D45) at 1:200 dilution. The antibody generated specific nuclear and cytoplasmic signal of Transportin 1 protein in the glandular cells while the connective tissue was largely negative.
Flow (Intracellular): Transportin 1 Antibody (D45) [NB600-1397] - HeLa cells were stained with Transportin 1 NB600-1397 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
(1 Review)
(5 Publications)
Species: Hu, Mu, Bv, Ca, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
PPIL2 Antibody
NBP1-85360
Western Blot: PPIL2 Antibody [NBP1-85360] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PPIL2 Antibody [NBP1-85360] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PPIL2 Antibody [NBP1-85360] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Cyclophilin-F
Antibody
NBP2-15079
Western Blot: Cyclophilin-F Antibody [NBP2-15079] - Wild-type (WT) and Cyclophilin F knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Cyclophilin-F antibody diluted at 1:5000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cyclophilin-F Antibody [NBP2-15079] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Cyclophilin-F Antibody [NBP2-15079] - Paraffin-embedded Colon ca, using antibody at 1:250 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FKBP9 Antibody
NBP1-83887
FKBP9 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FKBP9 Antibody (NBP1-83887)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FKBP9 Antibody (NBP1-83887) (0)

There are no reviews for FKBP9 Antibody (NBP1-83887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP9 Antibody (NBP1-83887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FKBP9 Products

Bioinformatics Tool for FKBP9 Antibody (NBP1-83887)

Discover related pathways, diseases and genes to FKBP9 Antibody (NBP1-83887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP9 Antibody (NBP1-83887)

Discover more about diseases related to FKBP9 Antibody (NBP1-83887).

PTMs for FKBP9 Antibody (NBP1-83887)

Learn more about PTMs related to FKBP9 Antibody (NBP1-83887).

Blogs on FKBP9

There are no specific blogs for FKBP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FKBP9