FKBP51/FKBP5 Antibody

Images

 
Western Blot: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of FKBP5 expression in human placenta.
Immunocytochemistry/ Immunofluorescence: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of purified antibody to FKBP5 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of purified antibody to FKBP5 on formalin-fixed paraffin-embedded human endometrium. (antibody concentration 3 ug/ml)
Western Blot: FKBP51/FKBP5 Antibody [H00002289-B01P] - Analysis of FKBP5 expression in transfected 293T cell line by FKBP5 polyclonal antibody. Lane 1: FKBP5 transfected lysate(50.27 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FKBP51/FKBP5 Antibody Summary

Immunogen
FKBP5 (NP_004108.1, 1 a.a. - 457 a.a.) full-length human protein. MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FKBP5
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is useful for WB, Functional, IF and IHC-P.
Publications
Read Publications using H00002289-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FKBP51/FKBP5 Antibody

  • 51 kDa FKBP
  • 54 kDa progesterone receptor-associated immunophilin
  • AIG6,51 kDa FK506-binding protein
  • Androgen-regulated protein 6
  • Dit1
  • FF1 antigen
  • FK506 binding protein 5
  • FK506-binding protein 5
  • FKBP5
  • FKBP-5
  • FKBP51
  • FKBP-51
  • FKBP51PPIase FKBP5
  • FKBP54
  • FKBP54EC 5.2.1.8
  • HSP90-binding immunophilin
  • MGC111006
  • p54
  • P54,51 kDa FK506-binding protein 5
  • peptidyl-prolyl cis-trans isomerase FKBP5
  • peptidylprolyl cis-trans isomerase
  • PPIase
  • Ptg-10
  • rotamase
  • T-cell FK506-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB7670
Species: Hu
Applications: WB, ICC
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for FKBP5/FKBP51 Antibody (H00002289-B01P)(3)

Reviews for FKBP5/FKBP51 Antibody (H00002289-B01P) (0)

There are no reviews for FKBP5/FKBP51 Antibody (H00002289-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP5/FKBP51 Antibody (H00002289-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP51/FKBP5 Products

Bioinformatics Tool for FKBP5/FKBP51 Antibody (H00002289-B01P)

Discover related pathways, diseases and genes to FKBP5/FKBP51 Antibody (H00002289-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP5/FKBP51 Antibody (H00002289-B01P)

Discover more about diseases related to FKBP5/FKBP51 Antibody (H00002289-B01P).
 

Pathways for FKBP5/FKBP51 Antibody (H00002289-B01P)

View related products by pathway.

PTMs for FKBP5/FKBP51 Antibody (H00002289-B01P)

Learn more about PTMs related to FKBP5/FKBP51 Antibody (H00002289-B01P).
 

Research Areas for FKBP5/FKBP51 Antibody (H00002289-B01P)

Find related products by research area.

Blogs on FKBP51/FKBP5

There are no specific blogs for FKBP51/FKBP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP51/FKBP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP5
Entrez
Uniprot