FKBP25 Antibody

Images

 
Western Blot: FKBP25 Antibody [NBP1-54354] - Human Hela, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: FKBP25 Antibody [NBP1-54354] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FKBP25 Antibody [NBP1-54354] - Human 721_B, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: FKBP25 Antibody [NBP1-54354] - Human MCF7, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in MCF7.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP25 Antibody Summary

Immunogen
Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FKBP3 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FKBP25 Antibody

  • EC 5.2.1.8,25 kDa FK506-binding protein
  • FK506 binding protein 3, 25kDa
  • FK506-binding protein 3 (25kD)
  • FK506-binding protein 3
  • FKBP25
  • FKBP25,25 kDa FKBP
  • FKBP3
  • FKBP-3
  • Immunophilin FKBP25
  • peptidyl-prolyl cis-trans isomerase FKBP3
  • PPIase FKBP3
  • PPIase
  • rapamycin binding protein
  • Rapamycin-selective 25 kDa immunophilin
  • rotamase
  • T-cell

Background

FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP1-54354
Species: Hu
Applications: WB

Publications for FKBP25 Antibody (NBP1-54354) (0)

There are no publications for FKBP25 Antibody (NBP1-54354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP25 Antibody (NBP1-54354) (0)

There are no reviews for FKBP25 Antibody (NBP1-54354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP25 Antibody (NBP1-54354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP25 Products

Bioinformatics Tool for FKBP25 Antibody (NBP1-54354)

Discover related pathways, diseases and genes to FKBP25 Antibody (NBP1-54354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP25 Antibody (NBP1-54354)

Discover more about diseases related to FKBP25 Antibody (NBP1-54354).
 

Pathways for FKBP25 Antibody (NBP1-54354)

View related products by pathway.

PTMs for FKBP25 Antibody (NBP1-54354)

Learn more about PTMs related to FKBP25 Antibody (NBP1-54354).
 

Research Areas for FKBP25 Antibody (NBP1-54354)

Find related products by research area.

Blogs on FKBP25

There are no specific blogs for FKBP25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP3
Entrez
Uniprot