FKBP25 Antibody - BSA Free

Western Blot: FKBP25 Antibody [NBP1-54354] - Human Hela, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in HeLa.

Western Blot: FKBP25 Antibody [NBP1-54354] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Western Blot: FKBP25 Antibody [NBP1-54354] - Human 721_B, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in 721_B.

Western Blot: FKBP25 Antibody [NBP1-54354] - Human MCF7, Antibody Dilution: 1.0 ug/ml FKBP3 is supported by BioGPS gene expression data to be expressed in MCF7.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FKBP25 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3. Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FKBP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FKBP25 Antibody - BSA Free

• EC 5.2.1.8,25 kDa FK506-binding protein
• FK506 binding protein 3, 25kDa
• FK506-binding protein 3 (25kD)
• FK506-binding protein 3
• FKBP25
• FKBP25,25 kDa FKBP
• FKBP3
• FKBP-3
• Immunophilin FKBP25
• peptidyl-prolyl cis-trans isomerase FKBP3
• PPIase FKBP3
• PPIase
• rapamycin binding protein
• Rapamycin-selective 25 kDa immunophilin
• rotamase
• T-cell

Background

FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FKBP3
• Uniprot:
  • Q00688()