FKBP10 Antibody - BSA Free

Staining of human cell line U2OS shows localization to the Golgi apparatus.

Analysis in human cell line RT-4.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FKBP10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FKBP10 Antibody - BSA Free (NBP3-24849) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein FKBP10 using the following amino acid sequence: VVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGT
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FKBP10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FKBP10 Antibody - BSA Free

• 65 kDa FK506-binding protein
• 65 kDa FKBP
• EC 5.2.1.8
• FK506 binding protein 10 (65 kDa)
• FK506 binding protein 10, 65 kDa
• FK506-binding protein 10
• FKBP-10
• FKBP6
• FKBP-65
• FKBP65PPIase FKBP10
• FLJ20683
• FLJ22041
• FLJ23833
• hFKBP65
• Immunophilin FKBP65
• OI6
• peptidyl-prolyl cis-trans isomerase FKBP10
• PPIASE
• rotamase

Background

The FKBP10 gene encodes for a 582 amino acid long, 64 kDA peptidyl-prolyl cis-trans isomerase FKBP10 protein that accelerates the folding of proteins during synthesis through localizing to the endoplasmic reticulum and functioning as a molecular chaperone. FKBP10 is known to interact with various genes such as SLX1A, SLX1B, ELN, SLC2A4, and H2AFX. It has been researched regarding its role in carcinoma, bruck syndrome, osteogenesis imperfecta, ovarian cancer, and benign tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FKBP10