FKBP10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FKBP10 Antibody [NBP2-14016] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Immunohistochemistry-Paraffin: FKBP10 Antibody [NBP2-14016] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVP PHLAHGESGARGVPGSAVLLFEVELVSRED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP10 Protein (NBP2-14016PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP10 Antibody

  • 65 kDa FK506-binding protein
  • 65 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 10 (65 kDa)
  • FK506 binding protein 10, 65 kDa
  • FK506-binding protein 10
  • FKBP-10
  • FKBP6
  • FKBP-65
  • FKBP65PPIase FKBP10
  • FLJ20683
  • FLJ22041
  • FLJ23833
  • hFKBP65
  • Immunophilin FKBP65
  • OI6
  • peptidyl-prolyl cis-trans isomerase FKBP10
  • PPIASE
  • rotamase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58529
Species: Hu
Applications: ICC/IF
NBP2-14016
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FKBP10 Antibody (NBP2-14016) (0)

There are no publications for FKBP10 Antibody (NBP2-14016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP10 Antibody (NBP2-14016) (0)

There are no reviews for FKBP10 Antibody (NBP2-14016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FKBP10 Antibody (NBP2-14016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP10 Products

Bioinformatics Tool for FKBP10 Antibody (NBP2-14016)

Discover related pathways, diseases and genes to FKBP10 Antibody (NBP2-14016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP10 Antibody (NBP2-14016)

Discover more about diseases related to FKBP10 Antibody (NBP2-14016).
 

Pathways for FKBP10 Antibody (NBP2-14016)

View related products by pathway.

PTMs for FKBP10 Antibody (NBP2-14016)

Learn more about PTMs related to FKBP10 Antibody (NBP2-14016).

Blogs on FKBP10

There are no specific blogs for FKBP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP10