Ficolin-2 Antibody


Western Blot: Ficolin-2 Antibody [NBP1-60121] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Ficolin-2 Antibody Summary

Synthetic peptides corresponding to FCN2(ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)) The peptide sequence was selected from the N terminal of FCN2. Peptide sequence RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCN2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ficolin-2 Antibody

  • 37 kDa elastin-binding protein
  • Collagen/fibrinogen domain-containing protein 2
  • EBP-37ficolin (collagen/fibrinogen domain-containing lectin) 2 (hucolin)
  • FCN2
  • FCNL
  • FCNLficolin B
  • ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
  • Ficolin2
  • Ficolin-2
  • ficolin-B
  • ficolin-beta
  • Hucolin
  • L-Ficolin
  • P35
  • Serum lectin p35


The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is pre


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: WB, Simple Western, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu
Applications: WB

Publications for Ficolin-2 Antibody (NBP1-60121) (0)

There are no publications for Ficolin-2 Antibody (NBP1-60121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-2 Antibody (NBP1-60121) (0)

There are no reviews for Ficolin-2 Antibody (NBP1-60121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-2 Antibody (NBP1-60121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ficolin-2 Products

Bioinformatics Tool for Ficolin-2 Antibody (NBP1-60121)

Discover related pathways, diseases and genes to Ficolin-2 Antibody (NBP1-60121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-2 Antibody (NBP1-60121)

Discover more about diseases related to Ficolin-2 Antibody (NBP1-60121).

Pathways for Ficolin-2 Antibody (NBP1-60121)

View related products by pathway.

PTMs for Ficolin-2 Antibody (NBP1-60121)

Learn more about PTMs related to Ficolin-2 Antibody (NBP1-60121).

Blogs on Ficolin-2

There are no specific blogs for Ficolin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ficolin-2 Antibody and receive a gift card or discount.


Gene Symbol FCN2