Ficolin-2 Antibody

Images

 
Western Blot: Ficolin-2 Antibody [NBP1-60121] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Ficolin-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to FCN2(ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)) The peptide sequence was selected from the N terminal of FCN2. Peptide sequence RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
Clonality
Polyclonal
Host
Rabbit
Gene
FCN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCN2 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ficolin-2 Antibody

  • 37 kDa elastin-binding protein
  • Collagen/fibrinogen domain-containing protein 2
  • EBP-37ficolin (collagen/fibrinogen domain-containing lectin) 2 (hucolin)
  • FCN2
  • FCNL
  • FCNLficolin B
  • ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
  • Ficolin2
  • Ficolin-2
  • ficolin-B
  • ficolin-beta
  • Hucolin
  • L-Ficolin
  • P35
  • Serum lectin p35

Background

The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is pre

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP2-29467
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
MAB2091
Species: Hu
Applications: WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80962
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2307
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Ficolin-2 Antibody (NBP1-60121) (0)

There are no publications for Ficolin-2 Antibody (NBP1-60121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-2 Antibody (NBP1-60121) (0)

There are no reviews for Ficolin-2 Antibody (NBP1-60121). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-2 Antibody (NBP1-60121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ficolin-2 Antibody Products

Related Products by Gene

Bioinformatics Tool for Ficolin-2 Antibody (NBP1-60121)

Discover related pathways, diseases and genes to Ficolin-2 Antibody (NBP1-60121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-2 Antibody (NBP1-60121)

Discover more about diseases related to Ficolin-2 Antibody (NBP1-60121).
 

Pathways for Ficolin-2 Antibody (NBP1-60121)

View related products by pathway.

PTMs for Ficolin-2 Antibody (NBP1-60121)

Learn more about PTMs related to Ficolin-2 Antibody (NBP1-60121).

Blogs on Ficolin-2

There are no specific blogs for Ficolin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FCN2
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-60121 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

Ficolin-2 RNAi
H00002220-R02-20nmol