Ficolin-2 Antibody

Western Blot: Ficolin-2 Antibody [NBP1-60121] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Discontinued

Ficolin-2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to FCN2(ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)) The peptide sequence was selected from the N terminal of FCN2. Peptide sequence RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against FCN2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ficolin-2 Antibody

• 37 kDa elastin-binding protein
• Collagen/fibrinogen domain-containing protein 2
• EBP-37ficolin (collagen/fibrinogen domain-containing lectin) 2 (hucolin)
• FCN2
• FCNL
• FCNLficolin B
• ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
• Ficolin2
• Ficolin-2
• ficolin-B
• ficolin-beta
• Hucolin
• L-Ficolin
• P35
• Serum lectin p35

Background

The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is pre

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCN2
• Uniprot:
  • Q15485()