Ficolin-2 Antibody


Western Blot: Ficolin-2 Antibody [NBP1-60121] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Ficolin-2 Antibody Summary

Synthetic peptides corresponding to FCN2(ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)) The peptide sequence was selected from the N terminal of FCN2. Peptide sequence RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCN2 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ficolin-2 Antibody

  • 37 kDa elastin-binding protein
  • Collagen/fibrinogen domain-containing protein 2
  • EBP-37ficolin (collagen/fibrinogen domain-containing lectin) 2 (hucolin)
  • FCN2
  • FCNL
  • FCNLficolin B
  • ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
  • Ficolin2
  • Ficolin-2
  • ficolin-B
  • ficolin-beta
  • Hucolin
  • L-Ficolin
  • P35
  • Serum lectin p35


The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is pre


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Ficolin-2 Antibody (NBP1-60121) (0)

There are no publications for Ficolin-2 Antibody (NBP1-60121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-2 Antibody (NBP1-60121) (0)

There are no reviews for Ficolin-2 Antibody (NBP1-60121). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-2 Antibody (NBP1-60121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ficolin-2 Antibody Products

Related Products by Gene

Bioinformatics Tool for Ficolin-2 Antibody (NBP1-60121)

Discover related pathways, diseases and genes to Ficolin-2 Antibody (NBP1-60121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-2 Antibody (NBP1-60121)

Discover more about diseases related to Ficolin-2 Antibody (NBP1-60121).

Pathways for Ficolin-2 Antibody (NBP1-60121)

View related products by pathway.

PTMs for Ficolin-2 Antibody (NBP1-60121)

Learn more about PTMs related to Ficolin-2 Antibody (NBP1-60121).

Blogs on Ficolin-2

There are no specific blogs for Ficolin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Ficolin-2 Antibody and receive a gift card or discount.


Gene Symbol FCN2

Customers Who Bought This Also Bought