FIBP Antibody - BSA Free

Western Blot: FIBP Antibody [NBP3-04701] - Analysis of extracts of various cell lines, using FIBP antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunoprecipitation: FIBP Antibody [NBP3-04701] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug FIBP antibody (NBP3-04701). Western blot was performed from the immunoprecipitate using FIBP antibody (NBP3-04701) at a dilution of 1:1000.

Immunohistochemistry: FIBP Antibody - BSA Free [FIBP] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using FIBP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: FIBP Antibody - BSA Free [FIBP] - Western blot analysis of various lysates using FIBP Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

• Reactivity: Hu, Rt
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FIBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FIBP Antibody - BSA Free (NBP3-04701) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human FIBP (NP_004205.2). MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FIBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FIBP Antibody - BSA Free

• fibroblast growth factor (acidic) intracellular binding protein

Background

Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesisor inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that bindsselectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenicaction of aFGF. Two transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FIBP