FIBP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FIBP Antibody [NBP1-83903] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: FIBP Antibody [NBP1-83903] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FIBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FIBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FIBP Protein (NBP1-83903PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FIBP Antibody

  • fibroblast growth factor (acidic) intracellular binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

232-FA/CF
Species: Hu
MAB1593
Species: Hu
Applications: WB
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
AF641
Species: Mu
Applications: WB, IHC
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-59486
Species: Hu
Applications: WB, ELISA
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-98474
Species: Hu
Applications: WB
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76869
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46238
Species: Hu
Applications: WB, Flow, IHC

Publications for FIBP Antibody (NBP1-83903) (0)

There are no publications for FIBP Antibody (NBP1-83903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIBP Antibody (NBP1-83903) (0)

There are no reviews for FIBP Antibody (NBP1-83903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FIBP Antibody (NBP1-83903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FIBP Products

Bioinformatics Tool for FIBP Antibody (NBP1-83903)

Discover related pathways, diseases and genes to FIBP Antibody (NBP1-83903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIBP Antibody (NBP1-83903)

Discover more about diseases related to FIBP Antibody (NBP1-83903).
 

Pathways for FIBP Antibody (NBP1-83903)

View related products by pathway.

Research Areas for FIBP Antibody (NBP1-83903)

Find related products by research area.

Blogs on FIBP

There are no specific blogs for FIBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FIBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FIBP