Recombinant Human FHOD1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FHOD1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-99 of Human FHOD1

Source: Wheat Germ

Amino Acid Sequence: AGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FHOD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FHOD1 Protein

  • FH1/FH2 domain-containing protein 1
  • FHOS1
  • FHOSFormin homolog overexpressed in spleen 1
  • formin homology 2 domain containing 1
  • Formin homology 2 domain-containing protein 1

Background

This gene encodes a protein which is a member of the formin/diaphanous family of proteins. The gene is ubiquitously expressed but is found in abundance in the spleen. The encoded protein has sequence homology to diaphanous and formin proteins within the Formin Homology (FH)1 and FH2 domains. It also contains a coiled-coil domain, a collagen-like domain, two nuclear localization signals, and several potential PKC and PKA phosphorylation sites. It is a predominantly cytoplasmic protein and is expressed in a variety of human cell lines. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88461
Species: Hu
Applications: IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP2-24623
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FHOD1 Partial Recombinant Protein (H00029109-Q01) (0)

There are no publications for FHOD1 Partial Recombinant Protein (H00029109-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHOD1 Partial Recombinant Protein (H00029109-Q01) (0)

There are no reviews for FHOD1 Partial Recombinant Protein (H00029109-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHOD1 Partial Recombinant Protein (H00029109-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FHOD1 Partial Recombinant Protein (H00029109-Q01)

Discover related pathways, diseases and genes to FHOD1 Partial Recombinant Protein (H00029109-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHOD1 Partial Recombinant Protein (H00029109-Q01)

Discover more about diseases related to FHOD1 Partial Recombinant Protein (H00029109-Q01).
 

Pathways for FHOD1 Partial Recombinant Protein (H00029109-Q01)

View related products by pathway.

PTMs for FHOD1 Partial Recombinant Protein (H00029109-Q01)

Learn more about PTMs related to FHOD1 Partial Recombinant Protein (H00029109-Q01).
 

Research Areas for FHOD1 Partial Recombinant Protein (H00029109-Q01)

Find related products by research area.

Blogs on FHOD1.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Customers Who Bought This Also Bought

FHOD1 Antibody
NBP1-83900
RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FHOD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FHOD1