FGL2/Fibroleukin Antibody Summary
| Immunogen |
FGL2 (NP_006673.1, 1 a.a. - 439 a.a.) full-length human protein. MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
| Specificity |
FGL2 - fibrinogen-like 2, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FGL2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FGL2/Fibroleukin Antibody
Background
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Publications for FGL2/Fibroleukin Antibody (H00010875-D01P) (0)
There are no publications for FGL2/Fibroleukin Antibody (H00010875-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGL2/Fibroleukin Antibody (H00010875-D01P) (0)
There are no reviews for FGL2/Fibroleukin Antibody (H00010875-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FGL2/Fibroleukin Antibody (H00010875-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGL2/Fibroleukin Products
Research Areas for FGL2/Fibroleukin Antibody (H00010875-D01P)
Find related products by research area.
|
Blogs on FGL2/Fibroleukin