Recombinant Human FGF-22 Protein

Product Discontinued

Recombinant Human FGF-22 Protein Summary

• Description: FGF-22 (Human) Recombinant Protein
  
  Source: E. coli
  
  Amino Acid Sequence: MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
• Preparation Method: Escherichia coli expression system
• Details of Functionality: Activity was determined by the dose-dependent proliferation of 4MBr-5 cells, is typically 50-300 ng/mL.
• Protein/Peptide Type: Recombinant Protein
• Gene: FGF22

Applications/Dilutions

• Dilutions:
  • Functional
  • SDS-Page
• Application Notes: This product is useful for Func,SDS-PAGE.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: No additive Reconstitute with sterilized water.
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGF-22 Protein

• FGF22
• FGF-22
• fibroblast growth factor 22

Background

Acidic and basic fibroblast growth factors (FGFs) are members of a family of multifunctional polypeptide growth factors that stimulate proliferation of cells of mesenchymal, epithelial and neuroectodermal origin. Like other growth factors, FGFs act by binding and activating specific cell surface receptors. These receptors usually contain an extracellular ligand-binding region containing three immunoglobulin-like domains, a transmembrane domain and a cytoplasmic tyrosine kinase domain. Fibroblast growth factor- 22 (FGF-22) is a secreted protein whose gene is localized to human chromosome 19p13.3. FGF-22 is expressed preferentially in the inner root sheath of the hair follicle, suggesting that it is important in hair development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FGF22