FGF-11 Antibody


Western Blot: FGF11 Antibody [NBP1-69007] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

FGF-11 Antibody Summary

Synthetic peptides corresponding to FGF11 (fibroblast growth factor 11) The peptide sequence was selected from the N terminal of FGF11. Peptide sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against FGF11 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
25 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGF-11 Antibody

  • FGF11
  • FGF-11
  • FHF-3
  • FHF3Fibroblast growth factor homologous factor 3
  • fibroblast growth factor 11
  • FLJ16061
  • MGC102953
  • MGC45269


The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Func, PAGE
Species: Hu
Applications: WB, ELISA, PA
Species: Mu
Applications: Func, PAGE
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC
Species: Hu, Mu
Applications: WB, IHC, ICC, Neut
Species: Hu
Applications: WB, IHC

Publications for FGF-11 Antibody (NBP1-69007) (0)

There are no publications for FGF-11 Antibody (NBP1-69007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-11 Antibody (NBP1-69007) (0)

There are no reviews for FGF-11 Antibody (NBP1-69007). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-11 Antibody (NBP1-69007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF-11 Antibody Products

FGF-11 NBP1-69007

Related Products by Gene

Bioinformatics Tool for FGF-11 Antibody (NBP1-69007)

Discover related pathways, diseases and genes to FGF-11 Antibody (NBP1-69007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-11 Antibody (NBP1-69007)

Discover more about diseases related to FGF-11 Antibody (NBP1-69007).

Pathways for FGF-11 Antibody (NBP1-69007)

View related products by pathway.

PTMs for FGF-11 Antibody (NBP1-69007)

Learn more about PTMs related to FGF-11 Antibody (NBP1-69007).

Research Areas for FGF-11 Antibody (NBP1-69007)

Find related products by research area.

Blogs on FGF-11

There are no specific blogs for FGF-11, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol FGF11

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69007 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought