FGF-11 Antibody


Western Blot: FGF11 Antibody [NBP1-69007] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FGF-11 Antibody Summary

Synthetic peptides corresponding to FGF11 (fibroblast growth factor 11) The peptide sequence was selected from the N terminal of FGF11. Peptide sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FGF11 and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGF-11 Antibody

  • FGF11
  • FGF-11
  • FHF-3
  • FHF3Fibroblast growth factor homologous factor 3
  • fibroblast growth factor 11
  • FLJ16061
  • MGC102953
  • MGC45269


The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu
Species: Hu, Mu
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Species: Hu
Species: Mu
Applications: IHC
Species: Hu, Mu
Applications: WB, IHC, ICC, Neut
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB

Publications for FGF-11 Antibody (NBP1-69007) (0)

There are no publications for FGF-11 Antibody (NBP1-69007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-11 Antibody (NBP1-69007) (0)

There are no reviews for FGF-11 Antibody (NBP1-69007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-11 Antibody (NBP1-69007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF-11 Products

Bioinformatics Tool for FGF-11 Antibody (NBP1-69007)

Discover related pathways, diseases and genes to FGF-11 Antibody (NBP1-69007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-11 Antibody (NBP1-69007)

Discover more about diseases related to FGF-11 Antibody (NBP1-69007).

Pathways for FGF-11 Antibody (NBP1-69007)

View related products by pathway.

PTMs for FGF-11 Antibody (NBP1-69007)

Learn more about PTMs related to FGF-11 Antibody (NBP1-69007).

Research Areas for FGF-11 Antibody (NBP1-69007)

Find related products by research area.

Blogs on FGF-11

There are no specific blogs for FGF-11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF-11 Antibody and receive a gift card or discount.


Gene Symbol FGF11