FFAR4/GPR120 Antibody

Images

 
Immunohistochemistry: FFAR4/GPR120 Antibody [NBP1-89739] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FFAR4/GPR120 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRVVPQRLPGADQEISICTLIWPTIPGEISWDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FFAR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FFAR4/GPR120 Protein (NBP1-89739PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FFAR4/GPR120 Antibody

  • FFAR4
  • G protein-coupled receptor 120
  • G protein-coupled receptor 129
  • G protein-coupled receptor PGR4
  • GPR120
  • GPR129
  • G-protein coupled receptor 120
  • G-protein coupled receptor 129
  • G-protein coupled receptor GT01
  • G-protein coupled receptor PGR4
  • G-protein-coupled receptor GT01
  • GT01
  • MGC119984
  • O3FAR1
  • omega-3 fatty acid receptor 1
  • PGR4
  • PGR4DKFZp686F0824

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1537
Species: Hu
Applications: WB, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NLS6599
Species: Hu, Mk, Pm
Applications: IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14014
Species: Hu
Applications: IHC, IHC-P
NLS548
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB8864
Species: Hu
Applications: IHC
NLS343
Species: Hu, Eq, Mk
Applications: IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for FFAR4/GPR120 Antibody (NBP1-89739) (0)

There are no publications for FFAR4/GPR120 Antibody (NBP1-89739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FFAR4/GPR120 Antibody (NBP1-89739) (0)

There are no reviews for FFAR4/GPR120 Antibody (NBP1-89739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FFAR4/GPR120 Antibody (NBP1-89739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FFAR4/GPR120 Products

Bioinformatics Tool for FFAR4/GPR120 Antibody (NBP1-89739)

Discover related pathways, diseases and genes to FFAR4/GPR120 Antibody (NBP1-89739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for FFAR4/GPR120 Antibody (NBP1-89739)

Find related products by research area.

Blogs on FFAR4/GPR120

There are no specific blogs for FFAR4/GPR120, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FFAR4/GPR120 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FFAR4
Entrez
Uniprot