Recombinant Human FFAR2/GPR43 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FFAR2/GPR43 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-330 of Human GPR43 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FFAR2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FFAR2/GPR43 Protein

  • FFAR2
  • free fatty acid activated receptor 2
  • free fatty acid receptor 2
  • G protein-coupled receptor 43
  • GPR43
  • GPR43FFA2R
  • G-protein coupled receptor 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14014
Species: Hu
Applications: IHC, IHC-P
NB100-1537
Species: Hu
Applications: WB, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-00858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92180
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NLS548
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS343
Species: Hu, Eq, Mk
Applications: IHC, IHC-P
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
H00002867-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FFAR2/GPR43 Recombinant Protein (H00002867-P01) (0)

There are no publications for FFAR2/GPR43 Recombinant Protein (H00002867-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FFAR2/GPR43 Recombinant Protein (H00002867-P01) (0)

There are no reviews for FFAR2/GPR43 Recombinant Protein (H00002867-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FFAR2/GPR43 Recombinant Protein (H00002867-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FFAR2/GPR43 Products

Bioinformatics Tool for FFAR2/GPR43 Recombinant Protein (H00002867-P01)

Discover related pathways, diseases and genes to FFAR2/GPR43 Recombinant Protein (H00002867-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FFAR2/GPR43 Recombinant Protein (H00002867-P01)

Discover more about diseases related to FFAR2/GPR43 Recombinant Protein (H00002867-P01).
 

Pathways for FFAR2/GPR43 Recombinant Protein (H00002867-P01)

View related products by pathway.

PTMs for FFAR2/GPR43 Recombinant Protein (H00002867-P01)

Learn more about PTMs related to FFAR2/GPR43 Recombinant Protein (H00002867-P01).
 

Research Areas for FFAR2/GPR43 Recombinant Protein (H00002867-P01)

Find related products by research area.

Blogs on FFAR2/GPR43

There are no specific blogs for FFAR2/GPR43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FFAR2/GPR43 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FFAR2
Entrez