Ferroportin/SLC40A1 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Ferroportin/SLC40A1 Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human placenta using shows weak to moderate positivity in erythrocytes.
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human duodenum using Ferroportin/SLC40A1 Antibody shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human spleen using Ferroportin/SLC40A1 Antibody shows weak to moderate cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: Ferroportin/SLC40A1 Antibody [NBP2-49454] - Staining of human pancreas using Ferroportin/SLC40A1 Antibody shows no cytoplasmic positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Ferroportin/SLC40A1 Antibody - BSA Free Summary

Immunogen
This Ferroportin/SLC40A1 Antibody was developed against a recombinant protein corresponding to amino acids: VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC40A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
62.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Ferroportin/SLC40A1 Recombinant Protein Antigen (NBP2-49454PEP)

Reactivity Notes

Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ferroportin/SLC40A1 Antibody - BSA Free

  • Ferroportin
  • Ferroportin-1
  • FPN1
  • FPN1IREG1ferroportin 1
  • HFE4
  • HFE4ferroportin-1
  • IREG1
  • iron regulated gene 1
  • Iron-regulated transporter 1
  • member 3
  • MST079
  • MSTP079
  • MTP1
  • putative ferroportin 1 variant IIIB
  • SLC11A3
  • SLC11A3iron regulated gene 1
  • SLC40A1
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3
  • solute carrier family 40 (iron-regulated transporter), member 1
  • solute carrier family 40 member 1

Background

Ferroportin is a 12-transmembrane domain protein, belonging to the major facilitator superfamily of transporters of small molecules, that is localized to the plasma membrane. Human Ferroportin has a theoretical molecular weight of 62.5 kDa. Ferroportin (FPN1 or SLC40A1) functions as an iron-regulated transporter (highly expressed in placenta, intestine, muscle, spleen, macrophages etc.) and is the receptor for the iron-regulatory hormone, hepcidin. In iron metabolism, FPN1 plays a key role in intestinal iron absorption as well as cellular iron release and mediates iron absorption in the presence of ferroxidases, hephaestin (HP) and/or ceruloplasmin (CP). FPN1 is implicated in iron export from duodenal epithelial cells and in the transfer of iron between maternal and fetal circulation. FPN1 transports iron in the ferrous form whereas plasma transferrin only binds iron's ferric form. Ferroxidases are key players in oxidizing iron transported by FPN1 and without the activity of ferroxidases, FPN1 is internalized followed by degradation. While other cell types utilize the circulating or GPI-linked multicopper ferroxidase CP for FPN1, intestinal cells utilize a membrane-bound HP, a paralog of CP that also show interaction with FPN1 (1).

FPN1 regulation is dependent on the cell type and involves transcriptional, posttranscriptional, and posttranslational mechanisms including hepcidin-mediated endocytosis and proteolysis. Hepcidin controls the concentration of FPN1 in the membrane, with hepcidin deficiency resulting in iron overload (high iron) and hepcidin excess leading to iron restriction and anemia (2). Ferroportin disease or hemochromatosis type 4 (HFE4) is associated with distinct FPN1 variants with either reduced FPN1 cell surface expression/iron export capacity or hepcidin resistance and iron overload (3, 4).

References

1. De Domenico I, Ward DM, Kaplan J. (2011) Hepcidin and ferroportin: the new players in iron metabolism. Semin Liver Dis. 31(3):272-9. PMID: 21901657

2. Drakesmith H, Nemeth E, Ganz T. (2015) Ironing out Ferroportin. Cell Metab. 22(5):777-87. PMID: 26437604

3. Pietrangelo A. (2017) Ferroportin disease: pathogenesis, diagnosis and treatment. Haematologica. 102(12):1972-1984. PMID: 29101207

4. Vlasveld LT, Janssen R, Bardou-Jacquet E, Venselaar H, Hamdi-Roze H, Drakesmith H, Swinkels DW. (2019) Twenty Years of Ferroportin Disease: A Review or An Update of Published Clinical, Biochemical, Molecular, and Functional Features. Pharmaceuticals (Basel). 12(3). pii: E132. PMID: 31505869

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DHP250
Species: Hu
Applications: ELISA
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83250
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84071
Species: Hu
Applications: IHC,  IHC-P, WB
MAB7509
Species: Hu
Applications: IHC, KO, WB
MAB3120
Species: Hu
Applications: Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NBP3-41278
Species: Hu, Mu
Applications: IHC, WB
NB300-914
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-49454
Species: Hu
Applications: ICC/IF, IHC

Publications for Ferroportin/SLC40A1 Antibody (NBP2-49454) (0)

There are no publications for Ferroportin/SLC40A1 Antibody (NBP2-49454).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ferroportin/SLC40A1 Antibody (NBP2-49454) (0)

There are no reviews for Ferroportin/SLC40A1 Antibody (NBP2-49454). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ferroportin/SLC40A1 Antibody (NBP2-49454) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ferroportin/SLC40A1 Products

Research Areas for Ferroportin/SLC40A1 Antibody (NBP2-49454)

Find related products by research area.

Blogs on Ferroportin/SLC40A1

There are no specific blogs for Ferroportin/SLC40A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ferroportin/SLC40A1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC40A1