FCRL4/FcRH4/IRTA1 Antibody

Images

 
Western Blot: IRTA1 Antibody [NBP1-69383] - This Anti-FCRL4 antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCRL4/FcRH4/IRTA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FCRL4(Fc receptor-like 4) The peptide sequence was selected from the N terminal of FCRL4. Peptide sequence FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCRL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCRL4 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FCRL4/FcRH4/IRTA1 Antibody

  • CD307d antigen
  • CD307d
  • Fc receptor homolog 4
  • Fc receptor-like 4
  • FcRH4
  • FCRH4Fc receptor-like protein 4
  • FCRL4
  • FcR-like protein 4
  • hIFGP2
  • IFGP family protein 2
  • IFGP2
  • IGFP2
  • Immune receptor translocation-associated protein 1
  • immunoglobulin superfamily Fc receptor, gp42
  • immunoglobulin superfamily receptor translocation associated 1
  • IRTA1
  • IRTA1MGC150523
  • MGC150522

Background

FCRL4 may function as an inhibitor of the B cell receptor signaling and in the B cell-mediated immune response.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2048
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2087
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84703
Species: Hu
Applications: IHC, IHC-P
MAB7905
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF3126
Species: Hu
Applications: Flow, CyTOF-ready
AF382
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4705
Species: Hu
Applications: WB
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-69383
Species: Hu
Applications: WB

Publications for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383) (0)

There are no publications for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383) (0)

There are no reviews for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCRL4/FcRH4/IRTA1 Products

Bioinformatics Tool for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383)

Discover related pathways, diseases and genes to FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383)

Discover more about diseases related to FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383).
 

Pathways for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383)

View related products by pathway.

PTMs for FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383)

Learn more about PTMs related to FCRL4/FcRH4/IRTA1 Antibody (NBP1-69383).

Blogs on FCRL4/FcRH4/IRTA1

There are no specific blogs for FCRL4/FcRH4/IRTA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCRL4/FcRH4/IRTA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCRL4
Entrez
Uniprot