We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FCRL3/FcRH3 Recombinant Protein Antigen

Images

 
There are currently no images for FCRL3/FcRH3 Recombinant Protein Antigen (NBP2-62615PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FCRL3/FcRH3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCRL3.

Source: E. coli

Amino Acid Sequence: AQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FCRL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62615.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FCRL3/FcRH3 Recombinant Protein Antigen

  • CD307c
  • Fc receptor homolog 3
  • Fc receptor-like 3
  • Fc receptor-like protein 3
  • FcRH3
  • FCRL3
  • fcR-like protein 3
  • hIFGP3
  • IFGP3
  • immunoglobulin superfamily receptor translocation associated protein 3
  • IRTA3
  • SPAP2

Background

The FCRL3 gene codes for a member of the immunoglobulin receptor superfamily, a Fc receptor-like protein 3 that has seven isoforms: isoform 1: 734 amino acids long, 80 kDA; isoform 2: 639 amino acids long, nearly 70 kDA; isoform 3: 740 amino acids long, 81 kDA; isoform 4: 189 amino acids long, 21 kDA; isoform 5: 199 amino acids long, 22 kDA; isoform 6: 742 amino acid long, 81 kDA; and isoform 7: 707 amino acids long, 77 kDA. This protein functions in the moderation of the immune system as it obtains immunoreceptor-tyrosine activation motifs as well as immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain. It is known to interact with genes SYK, PTPN6, ZAP70, and PTPN11. FCRL3 is linked to multiple sclerosis, graves' disease, arthritis, lupus, rheumatoid arthritis, alopecia areata, behcet's disease, and primary biliary cirrhosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
AF3428
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-22412
Species: Hu
Applications: Flow, IHC, WB
NBP3-11832
Species: Hu
Applications: Flow
AF2087
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF7286
Species: Mu
Applications: CyTOF-ready, Flow
MAB7905
Species: Mu
Applications: CyTOF-ready, Flow, WB
NBP2-02082
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-14093
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
MAB4705
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
202-IL
Species: Hu
Applications: BA
NBP3-28697
Species: Hu
Applications: ELISA, Flow, Func
NBP2-61707
Species: Hu
Applications: ELISA, Flow, WB

Publications for FCRL3/FcRH3 Recombinant Protein Antigen (NBP2-62615PEP) (0)

There are no publications for FCRL3/FcRH3 Recombinant Protein Antigen (NBP2-62615PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRL3/FcRH3 Recombinant Protein Antigen (NBP2-62615PEP) (0)

There are no reviews for FCRL3/FcRH3 Recombinant Protein Antigen (NBP2-62615PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FCRL3/FcRH3 Recombinant Protein Antigen (NBP2-62615PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FCRL3/FcRH3 Products

Blogs on FCRL3/FcRH3

There are no specific blogs for FCRL3/FcRH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FCRL3/FcRH3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FCRL3