FCRL3/FcRH3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FCRL3/FcRH3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCRL3.
  
  

  Source: E. coli

  Amino Acid Sequence: AQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FCRL3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62615.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FCRL3/FcRH3 Recombinant Protein Antigen

• CD307c
• Fc receptor homolog 3
• Fc receptor-like 3
• Fc receptor-like protein 3
• FcRH3
• FCRL3
• fcR-like protein 3
• hIFGP3
• IFGP3
• immunoglobulin superfamily receptor translocation associated protein 3
• IRTA3
• SPAP2

Background

The FCRL3 gene codes for a member of the immunoglobulin receptor superfamily, a Fc receptor-like protein 3 that has seven isoforms: isoform 1: 734 amino acids long, 80 kDA; isoform 2: 639 amino acids long, nearly 70 kDA; isoform 3: 740 amino acids long, 81 kDA; isoform 4: 189 amino acids long, 21 kDA; isoform 5: 199 amino acids long, 22 kDA; isoform 6: 742 amino acid long, 81 kDA; and isoform 7: 707 amino acids long, 77 kDA. This protein functions in the moderation of the immune system as it obtains immunoreceptor-tyrosine activation motifs as well as immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain. It is known to interact with genes SYK, PTPN6, ZAP70, and PTPN11. FCRL3 is linked to multiple sclerosis, graves' disease, arthritis, lupus, rheumatoid arthritis, alopecia areata, behcet's disease, and primary biliary cirrhosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FCRL3