FCRL1/FcRH1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to FCRL1(Fc receptor-like 1) The peptide sequence was selected form the N terminal of FCRL1.
Peptide sequence MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FCRL1 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against FCRL1 and was validated on Western blot. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for FCRL1/FcRH1 Antibody
Background
FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, CyTOF-ready
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
Species: Hu
Applications: IHC, IHC-P
Publications for FCRL1/FcRH1 Antibody (NBP1-62286) (0)
There are no publications for FCRL1/FcRH1 Antibody (NBP1-62286).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FCRL1/FcRH1 Antibody (NBP1-62286) (0)
There are no reviews for FCRL1/FcRH1 Antibody (NBP1-62286).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FCRL1/FcRH1 Antibody (NBP1-62286) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional FCRL1/FcRH1 Products
Bioinformatics Tool for FCRL1/FcRH1 Antibody (NBP1-62286)
Discover related pathways, diseases and genes to FCRL1/FcRH1 Antibody (NBP1-62286). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for FCRL1/FcRH1 Antibody (NBP1-62286)
Discover more about diseases related to FCRL1/FcRH1 Antibody (NBP1-62286).
| | Pathways for FCRL1/FcRH1 Antibody (NBP1-62286)
View related products by pathway.
|
Blogs on FCRL1/FcRH1