FCAMR Antibody

Immunohistochemistry-Paraffin: Fc alpha/mu R Antibody [NBP2-62627] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: Fc alpha/mu R Antibody [NBP2-62627] - Immunohistochemistry analysis in human kidney and colon tissues using Anti-FCAMR antibody. Corresponding FCAMR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Fc alpha/mu R Antibody [NBP2-62627] - Staining of human colon shows low expression as expected.

Product Discontinued

FCAMR Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCAMR
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for FCAMR Antibody

• CD351 antigen
• CD351
• Fc alpha/mu R
• Fc alpha/mu receptor
• Fc receptor, IgA, IgM, high affinity
• FCA/MR
• FCAMR
• FKSG87
• high affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
• immunity related factor
• receptor for Fc fragment of IgA and IgM
• uR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCAMR