Fc epsilon RI beta/MS4A2 Antibody

Images

 
Western Blot: Fc epsilon RI beta/MS4A2 Antibody [H00002206-D01P] - Analysis of MS4A2 expression in transfected 293T cell line by MS4A2 polyclonal antibody.Lane 1: MS4A2 transfected lysate(26.50 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fc epsilon RI beta/MS4A2 Antibody Summary

Immunogen
MS4A2 (NP_000130.1, 1 a.a. - 244 a.a.) full-length human protein. MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Specificity
Reacts with membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fc epsilon RI beta/MS4A2 Antibody

  • APY
  • ATOPY
  • Fc epsilon receptor I beta-chain
  • Fc epsilon RI beta
  • Fc epsilonRIb
  • FCER1B
  • FCER1BIGEL
  • FCERI
  • High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain)
  • high affinity immunoglobulin epsilon receptor subunit beta
  • IgE Fc receptor subunit beta
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • IGHER
  • immunoglobulin E receptor, high affinity, beta polypeptide
  • Membrane-spanning 4-domains subfamily A member 2
  • membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide)
  • MS4A1
  • MS4A2

Background

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-470
Species: Hu
Applications: ELISA, Flow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AB-230-NA
Species: Hu
Applications: WB, Neut
NB100-63269
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69315
Species: Hu
Applications: WB

Publications for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P) (0)

There are no publications for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P) (0)

There are no reviews for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fc epsilon RI beta/MS4A2 Products

Bioinformatics Tool for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P)

Discover related pathways, diseases and genes to Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P)

Discover more about diseases related to Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P).
 

Pathways for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P)

View related products by pathway.

PTMs for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P)

Learn more about PTMs related to Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P).
 

Research Areas for Fc epsilon RI beta/MS4A2 Antibody (H00002206-D01P)

Find related products by research area.

Blogs on Fc epsilon RI beta/MS4A2

There are no specific blogs for Fc epsilon RI beta/MS4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fc epsilon RI beta/MS4A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A2
Entrez
Uniprot