Novus Biologicals products are now on bio-techne.com

FBXW2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXW2 Antibody [NBP2-39089] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FBXW2 Antibody [NBP2-39089] - Staining of human duodenum shows strong granular cytoplasmic positivity in a subset of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXW2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXW2 Protein (NBP2-39089PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXW2 Antibody

  • F-box and WD repeat domain containing 2
  • F-box and WD-40 domain protein 2
  • F-box and WD-40 domain-containing protein 2
  • F-box/WD repeat-containing protein 2
  • FBW2Fwd2
  • FWD2
  • Md6
  • MGC117371
  • Protein MD6

Background

F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. A large family of mammalian F-box proteins has recently been identified and classified into three groups based on the presence of either the WD-40 repeats, the leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. The FBXW2 gene product, the second identified member of the F-box gene family, contains multiple WD-40 repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

255-SC
Species: Hu
Applications: BA
H00008521-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-16092
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20380
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-52158
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84850
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00026224-M03
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84721
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-33040
Species: Hu
Applications: WB

Publications for FBXW2 Antibody (NBP2-39089) (0)

There are no publications for FBXW2 Antibody (NBP2-39089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW2 Antibody (NBP2-39089) (0)

There are no reviews for FBXW2 Antibody (NBP2-39089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXW2 Antibody (NBP2-39089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW2
Uniprot