FBXW10 Antibody

Western Blot: FBXW10 Antibody [NBP1-79495] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Discontinued

FBXW10 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human FBXW10The immunogen for this antibody is FBXW10. Peptide sequence SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXW10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBXW10 Antibody

• F-box and WD repeat domain containing 10
• F-box protein
• F-box/WD repeat-containing protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXW10 Antibody (NBP1-79495)(1)

Publication using NBP1-79495

• Kong LR, Tan TZ, Ong WR et al. Belinostat exerts antitumor cytotoxicity through the ubiquitin-proteasome pathway in lung squamous cell carcinoma Mol Oncol 2017-08-01 [PMID: 28397399] (WB, Human)

Bioinformatics

• Gene Symbol: FBXW10