FBXO18 Antibody

Images

 
Immunohistochemistry-Paraffin: FBXO18 Antibody [NBP1-83921] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXO18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQMTHDGYLKLWQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FBXO18 Recombinant Protein Antigen (NBP1-83921PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXO18 Antibody

  • FBH1
  • F-box only protein 18
  • F-box protein, helicase, 18
  • Fbx18
  • FLJ14590
  • helicase, 18
  • MGC141937

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-58116
Species: Hu
Applications: ICC/IF
MAB4697
Species: Hu
Applications: WB
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32054
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for FBXO18 Antibody (NBP1-83921) (0)

There are no publications for FBXO18 Antibody (NBP1-83921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO18 Antibody (NBP1-83921) (0)

There are no reviews for FBXO18 Antibody (NBP1-83921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FBXO18 Antibody (NBP1-83921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO18 Products

Bioinformatics Tool for FBXO18 Antibody (NBP1-83921)

Discover related pathways, diseases and genes to FBXO18 Antibody (NBP1-83921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO18 Antibody (NBP1-83921)

Discover more about diseases related to FBXO18 Antibody (NBP1-83921).
 

Pathways for FBXO18 Antibody (NBP1-83921)

View related products by pathway.

PTMs for FBXO18 Antibody (NBP1-83921)

Learn more about PTMs related to FBXO18 Antibody (NBP1-83921).

Blogs on FBXO18

There are no specific blogs for FBXO18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO18