Fbxl8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Fbxl8 Antibody [NBP2-34012] - staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Fbxl8 Antibody [NBP2-34012] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fbxl8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVL
Specificity
Specificity of human Fbxl8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Fbxl8 Protein (NBP2-34012PEP)
Publications
Read Publication using
NBP2-34012 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fbxl8 Antibody

  • FBL8
  • F-box and leucine-rich repeat protein 8FLJ11278
  • F-box protein FBL8
  • F-box/LRR-repeat protein 8
  • MGC19959

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-177
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-47579
Species: Hu
Applications: WB, IB, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt, Ma, Mar
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-2564
Species: Hu
Applications: WB
AF756
Species: Mu
Applications: WB, IHC
NBP1-83919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57636
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-34012
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Fbxl8 Antibody (NBP2-34012)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Fbxl8 Antibody (NBP2-34012) (0)

There are no reviews for Fbxl8 Antibody (NBP2-34012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Fbxl8 Antibody (NBP2-34012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fbxl8 Products

Bioinformatics Tool for Fbxl8 Antibody (NBP2-34012)

Discover related pathways, diseases and genes to Fbxl8 Antibody (NBP2-34012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fbxl8 Antibody (NBP2-34012)

Discover more about diseases related to Fbxl8 Antibody (NBP2-34012).

PTMs for Fbxl8 Antibody (NBP2-34012)

Learn more about PTMs related to Fbxl8 Antibody (NBP2-34012).

Blogs on Fbxl8

There are no specific blogs for Fbxl8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fbxl8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL8
Uniprot