LRRC29 Antibody


Western Blot: LRRC29 Antibody [NBP1-83919] - Analysis in control (vector only transfected HEK293T lysate) and LRRC29 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: LRRC29 Antibody [NBP1-83919] - Staining of human esophagus shows moderate positivity in squamous epithelial cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LRRC29 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: WPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
Specificity of human LRRC29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRRC29 Protein (NBP1-83919PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LRRC29 Antibody

  • FBL9F-box and leucine-rich repeat protein 9FBXL9
  • F-box protein FBL9
  • F-box/LRR-repeat protein 9
  • leucine rich repeat containing 29
  • leucine-rich repeat-containing protein 29


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for LRRC29 Antibody (NBP1-83919) (0)

There are no publications for LRRC29 Antibody (NBP1-83919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC29 Antibody (NBP1-83919) (0)

There are no reviews for LRRC29 Antibody (NBP1-83919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC29 Antibody (NBP1-83919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for LRRC29 Antibody (NBP1-83919)

Discover related pathways, diseases and genes to LRRC29 Antibody (NBP1-83919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC29 Antibody (NBP1-83919)

Discover more about diseases related to LRRC29 Antibody (NBP1-83919).

PTMs for LRRC29 Antibody (NBP1-83919)

Learn more about PTMs related to LRRC29 Antibody (NBP1-83919).

Blogs on LRRC29

There are no specific blogs for LRRC29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRRC29 Antibody and receive a gift card or discount.


Gene Symbol LRRC29