Fbl14 Antibody

Images

 
Western Blot: Fbl14 Antibody [NBP1-79520] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fbl14 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human FBXL14. Peptide sequence WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Zebrafish (100%), Rabbit (100%), Guinea Pig (100%), Equine (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FBXL14 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fbl14 Antibody

  • FBL14
  • F-box and leucine-rich repeat protein 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
NBP2-67320
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85920
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28641
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-30649
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Dual ISH-IHC
NBP2-27293
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88178
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for Fbl14 Antibody (NBP1-79520) (0)

There are no publications for Fbl14 Antibody (NBP1-79520).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fbl14 Antibody (NBP1-79520) (0)

There are no reviews for Fbl14 Antibody (NBP1-79520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fbl14 Antibody (NBP1-79520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fbl14 Products

Bioinformatics Tool for Fbl14 Antibody (NBP1-79520)

Discover related pathways, diseases and genes to Fbl14 Antibody (NBP1-79520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fbl14 Antibody (NBP1-79520)

Discover more about diseases related to Fbl14 Antibody (NBP1-79520).
 

Pathways for Fbl14 Antibody (NBP1-79520)

View related products by pathway.

PTMs for Fbl14 Antibody (NBP1-79520)

Learn more about PTMs related to Fbl14 Antibody (NBP1-79520).

Blogs on Fbl14

There are no specific blogs for Fbl14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fbl14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL14
Uniprot